Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewParathyroid hormone (1-34) (human)
Description: Parathyroid hormone (PTH) receptor agonist
Alternative Names: PTH 1-34,hPTH (1-34),Teriparatide
Purity: ≥95% (HPLC)
Biological Activity for Parathyroid hormone (1-34) (human)
Parathyroid hormone (1-34) (human) is a human parathyroid hormone (hPTH) peptide fragment; contains the 34 N-terminal residues of hPTH. Agonist at parathyroid 1 (PTH1) and parathyroid 2 (PTH2) receptors.
Technical Data for Parathyroid hormone (1-34) (human)
| M. Wt | 4117.75 |
| Formula | C181H291N55O51S2 |
| Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 52232-67-4 |
| PubChem ID | 16132393 |
| InChI Key | OGBMKVWORPGQRR-UMXFMPSGSA-N |
| Smiles | [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for Parathyroid hormone (1-34) (human)
| Solubility | Soluble to 0.40 mg/ml in water |
Product Datasheets for Parathyroid hormone (1-34) (human)
References for Parathyroid hormone (1-34) (human)
References are publications that support the biological activity of the product.
Dobnig and Turner (1997) The effects of programmed administration of human parathyroid hormone fragment (1-34) on bone histomorphometry and serum chemistry in rats. Endocrinology 138 4607 PMID: 9348185
Manabe et al (2007) Human parathyroid hormone (1-34) accelerates natural fracture healing process in the femoral osteotomy model of cynomolgus monkeys. Bone 40 1475 PMID: 17369013
Niall et al (1974) The amino acid sequence of the amino-terminal 37 residues of human parathyroid hormone. Proc.Natl.Acad.Sci. 71 384
If you know of a relevant reference for Parathyroid hormone (1-34) (human), please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: Parathyroid hormone (1-34) (human), Parathyroid hormone (1-34) (human) supplier, Parathyroid, hormone, PTH, receptors, agonists, PTH134, 1-34, teriparatide, (1-34), hPTH, Teriparatide, Hormone, Receptors, 3011, Tocris Bioscience
⚠ WARNING: This product can expose you to chemicals including Teriparatide, which is known to the State of California to cause cancer. For more information, go to www.P65Warnings.ca.gov
2 Citations for Parathyroid hormone (1-34) (human)
Citations are publications that use Tocris products. Selected citations for Parathyroid hormone (1-34) (human) include:
Li et al (2019) TGFβ-induced degradation of TRAF3 in mesenchymal progenitor cells causes age-related osteoporosis. Nat Commun 10 2795 PMID: 31243287
Reinisch et al (2017) Generation and use of a humanized bone-marrow-ossicle niche for hematopoietic xenotransplantation into mice. Nat Protoc 12 2169 PMID: 28933777
Do you know of a great paper that uses Parathyroid hormone (1-34) (human) from Tocris? Please let us know.
Reviews for Parathyroid hormone (1-34) (human)
There are currently no reviews for this product. Be the first to review Parathyroid hormone (1-34) (human) and earn rewards!
Have you used Parathyroid hormone (1-34) (human)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image