Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewCharybdotoxin
Discontinued Product
1087 has been discontinued.
View all Calcium-Activated Potassium (K<sub>Ca</sub>) Channels products.
Description: KCa (BK) channel blocker
Alternative Names: ChTx
Biological Activity for Charybdotoxin
Charybdotoxin is a specific inhibitor of the big conductance Ca2+-activated K+ channel.
Technical Data for Charybdotoxin
| M. Wt | 4295.95 |
| Formula | C176H277N57O55S7 |
| Sequence |
XFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Modifications: X-1 = Glp, Disulfide bridge between 7 - 28, 13 - 33,17 - 35, Ser-37 = C-terminal OH) |
| Storage | Desiccate at -20°C |
| CAS Number | 95751-30-7 |
| PubChem ID | 102594130 |
| InChI Key | CNVQLPPZGABUCM-UHFFFAOYSA-N |
| Smiles | [H]N1[C@@H](CCC1=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC3=CNC=N3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](NC1=O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CC1=CNC4=C1C=CC=C4)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N3)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC2=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(O)=O)[C@@H](C)O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for Charybdotoxin
References for Charybdotoxin
References are publications that support the biological activity of the product.
Asano et al (1993) Charybdotoxin-sensitive K+ channels regulate the myogenic tone in the resting state of arteries from spontaneously hypertensive rats. Br.J.Pharmacol. 108 214 PMID: 7679030
Gimenez-Gallego et al (1988) Purification, sequence, and model structure of charybdotoxin, a potent selective inhibitor of calcium activated potassium channels. Proc.Natl.Acad.Sci.U.S.A. 85 3329 PMID: 2453055
Miller et al (1985) Charybdotoxin, a protein inhibitor of single Ca2+ activated K+ channels from mammalian skeletal muscle. Nature 313 316 PMID: 2578618
View Related Products by Target
View Related Products by Product Action
Keywords: Charybdotoxin, Charybdotoxin supplier, K+, channel, blockers, high, conductance, Ca2+-dependent, Potassium, KCa, Channels, ca2+-activated, ca2+-dependent, venoms, ChTx, Ca2+-Activated, 1087, Tocris Bioscience
6 Citations for Charybdotoxin
Citations are publications that use Tocris products. Selected citations for Charybdotoxin include:
Ohya et al (2011) Involvement of dominant-negative spliced variants of the intermediate conductance Ca2+-activated K+ channel, K(Ca)3.1, in immune function of lymphoid cells. J Biol Chem 286 16940 PMID: 21345794
Pulkkinen et al (2012) The bitter taste receptor (TAS2R) agonists denatonium and chloroquine display distinct patterns of relaxation of the guinea pig trachea. Am J Physiol Lung Cell Mol Physiol 303 L956 PMID: 22962016
Manaves et al (2004) Calcium and Vitamin D increase mRNA levels for the growth control hIK1 channel in human epidermal keratinocytes but functional channels are not observed. Sci Rep 4 7 PMID: 15200683
Thompson et al (2015) Small-conductance calcium-activated potassium (SK) channels in the amygdala mediate pain-inhibiting effects of clinically available R.zole in a rat model of arthritis pain. BMC Dermatol 11 51 PMID: 26311432
Mannowetz et al (2013) Slo1 is the principal potassium channel of human spermatozoa. Elife (Cambridge) 2 e01009 PMID: 24137539
Kanthesh et al (2013) Enhanced K(+) secretion in dextran sulfate-induced colitis reflects upregulation of large conductance apical K(+) channels (BK; Kcnma1). Am J Physiol Cell Physiol 305 C972 PMID: 23986198
Reviews for Charybdotoxin
Average Rating: 5 (Based on 1 Review.)
Have you used Charybdotoxin?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Filter by:
Excellent BK channel blocker for research purposes.
By
Anonymous on 10/15/2018
Assay Type: In Vitro
Species: Human
Charybdotoxin shows excellent BK channel blocking. For studies comparing blocking and opening of BK channels this is a great one.Soluble in water. Shows high level of BK channel blocking.
