Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewCRF (human, rat)
Description: Stimulates ACTH release
Alternative Names: Corticotropin-Releasing Factor (human,rat)
Purity: ≥95% (HPLC)
Biological Activity for CRF (human, rat)
CRF (human, rat) is a endogenous peptide agonist for the CRF receptor (Ki values are 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively). Stimulates the synthesis and release of ACTH from the anterior pituitary.
Licensing Information
Sold with the permission of the SALK Institute
Technical Data for CRF (human, rat)
| M. Wt | 4758 |
| Formula | C208H344N60O63S2 |
| Sequence |
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII (Modifications: Ile-41 = C-terminal amide) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 86784-80-7 |
| PubChem ID | 16132357 |
| InChI Key | VXFVFWFSJFSXHN-FAUHKOHMSA-N |
| Smiles | [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for CRF (human, rat)
| Solubility | Soluble to 1.10 mg/ml in water |
Product Datasheets for CRF (human, rat)
References for CRF (human, rat)
References are publications that support the biological activity of the product.
Perrin and Vale (1999) Corticotropin releasing factor receptors and their ligand family. Ann.N.Y.Acad.Sci. 885 312 PMID: 10816663
Rivier et al (1986) Mediation by cortico. releasing factor (CRF) of adenohypophysial hormone secretion. Annu.Rev.Physiol. 48 475 PMID: 2871808
Souza et al (1984) Corticotropin-releasing factor receptors in rat forebrain: autoradiographic identification. Science 224 1449 PMID: 6328656
Tache et al (1983) Inhibition of gastric acid secretion in rats by intracerebral injection of corticotropin-releasing factor. Science 222 935 PMID: 6415815
Perrin et al (1999) Comparison of an agonist, urocortin, and an antagonist, astressin, as radioligands for characterization of corticotropin-releasing factor receptors. J.Pharmacol.Exp.Ther. 288 729 PMID: 9918582
Vale et al (1981) Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of cortico. and β-endorphin. Science 213 1394 PMID: 6267699
If you know of a relevant reference for CRF (human, rat), please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: CRF (human, rat), CRF (human, rat) supplier, Stimulates, ACTH, release, Corticotropin-Releasing, Factor, Non-Selective, CRF, Receptors, agonists, (human,, rat), Non-selective, 1151, Tocris Bioscience
10 Citations for CRF (human, rat)
Citations are publications that use Tocris products. Selected citations for CRF (human, rat) include:
Navarro et al (2015) Orexin-corticotropin-releasing factor receptor heteromers in the ventral tegmental area as targets for cocaine. Psychoneuroendocrinology 35 6639 PMID: 25926444
Land et al (2008) The dysphoric component of stress is encoded by activation of the dynorphin kappa-opioid system. J Neurosci 28 407 PMID: 18184783
Xie et al (2019) Exchange protein directly activated by cAMP 2 is required for CRH-releasing hormone-mediated spine loss. Eur J Neurosci PMID: 31199033
Song et al (2016) Systemic pro-inflammatory response facilitates the development of cerebral edema during short hypoxia. J Neurosci 13 63 PMID: 26968975
Klampfl et al (2016) CRF-R1 activation in the anterior-dorsal BNST induces maternal neglect in lactating rats via an HPA axis-independent central mechanism. J Neuroinflammation 64 89 PMID: 26630389
Gray et al (2015) Corticotropin-releasing hormone drives anandamide hydrolysis in the amygdala to promote anxiety. J Neurosci 35 3879 PMID: 25740517
Raftogianni et al (2018) Deciphering the Contributions of CRH Receptors in the Brain and Pituitary to Stress-Induced Inhibition of the Reproductive Axis. Front Mol Neurosci 11 305 PMID: 30214395
Lowery-Gionta et al (2012) Corticotropin releasing factor signaling in the central amygdala is recruited during binge-like ethanol consumption in C57BL/6J mice. J Neurosci 32 3405 PMID: 22399763
Dermitzaki et al (2007) Corticotropin-releasing factor (CRF) and the urocortins differentially regulate catecholamine secretion in human and rat adrenals, in a CRF receptor type-specific manner. Endocrinology 148 1524 PMID: 17194738
Silberman and Winder (2013) Corticotropin releasing factor and catecholamines enhance glutamatergic neurotransmission in the lateral subdivision of the central amygdala. Neuropharmacology 70 316 PMID: 23470280
Do you know of a great paper that uses CRF (human, rat) from Tocris? Please let us know.
Reviews for CRF (human, rat)
There are currently no reviews for this product. Be the first to review CRF (human, rat) and earn rewards!
Have you used CRF (human, rat)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Depression Poster
Major depressive disorder is characterized by depressed mood and a loss of interest and/or pleasure. Updated in 2015 this poster highlights presynaptic and postsynaptic targets for the potential treatment of major depressive disorder, as well as outlining the pharmacology of currently approved antidepressant drugs.