Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewGIP (1-39)
Description: Highly potent insulinotropic peptide; GIP agonist
Alternative Names: Gastric Inhibitory Polypeptide (1-39)
Purity: ≥95% (HPLC)
Biological Activity for GIP (1-39)
GIP (1-39) is an endogenous truncated form of the incretin hormone GIP. More potent at stimulating glucose-dependent insulin secretion from rat pancreatic β-cells than GIP (Cat. No 2084).
Technical Data for GIP (1-39)
| M. Wt | 4633.21 |
| Formula | C210H316N56O61S |
| Sequence | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 725474-97-5 |
| PubChem ID | 71300624 |
| InChI Key | TWSALRJGPBVBQU-PKQQPRCHSA-N |
| Smiles | [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for GIP (1-39)
| Solubility | Soluble to 10 mg/ml in water |
Product Datasheets for GIP (1-39)
References for GIP (1-39)
References are publications that support the biological activity of the product.
Xie et al (2004) GIP1-39, a novel Insotropic peptide form and aspects on its mechanism of action. Regul.Peptides 121 107
If you know of a relevant reference for GIP (1-39), please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: GIP (1-39), GIP (1-39) supplier, potent, insulinotropic, peptide, Gastric, inhibitory, Peptide, Receptors, Glucose-Dependent, Insulinotropic, GIP, Glucagon, Inhibitory, Polypeptide, (1-39), 2257, Tocris Bioscience
Citations for GIP (1-39)
Citations are publications that use Tocris products.
Currently there are no citations for GIP (1-39). Do you know of a great paper that uses GIP (1-39) from Tocris? Please let us know.
Reviews for GIP (1-39)
There are currently no reviews for this product. Be the first to review GIP (1-39) and earn rewards!
Have you used GIP (1-39)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Peptides Involved in Appetite Modulation Scientific Review
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.