Amyloid β-peptide (1-40) (rat)

Discontinued Product

2424 has been discontinued.

Description: Amyloid β-protein fragment
Datasheet
Citations
Reviews
Literature (1)

Biological Activity for Amyloid β-peptide (1-40) (rat)

Amyloid β-peptide (1-40) (rat) is a rat form of the amyloid β-peptide found in plaques associated with Alzheimer's disease. Shown to have both neurotrophic and neurotoxic effects.

Technical Data for Amyloid β-peptide (1-40) (rat)

M. Wt 4233.76
Formula C190H291N51O57S
Sequence DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Storage Desiccate at -20°C
CAS Number 144409-98-3
PubChem ID 90488761
InChI Key HAWSUONKNKRLRH-QSLPLQOHSA-N
Smiles [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for Amyloid β-peptide (1-40) (rat)

Certificate of Analysis / Product Datasheet
Select another batch:

References for Amyloid β-peptide (1-40) (rat)

References are publications that support the biological activity of the product.

Yankner et al (1990) Neurotrophic and neurotoxic effects of amyloid beta protein: reversal by tachykinin neuropeptides. Science 250 279 PMID: 2218531

Cleary et al (1995) Beta-amyloid(1-40) effects on behavior and memory. Brain Res. 682 69 PMID: 7552329

Miguel-Hidalgo and Cacabelos (1998) Beta-amyloid(1-40)-induced neurodegeneration in the rat hippocampal neurons of the CA1 subfield. Acta Neuropathol. 95 455 PMID: 9600591

Kowalska and Badellino (1994) β-Amyloid protein induces platelet aggregation and supports platelet adhesion. Biochem.Biophys.Res.Comm. 205 1829

View Related Products by Target

Keywords: Amyloid beta-peptide (1-40) (rat), Amyloid beta-peptide (1-40) (rat) supplier, Amyloid, β-protein, beta-protein, fragment, β-Amyloid, beta-Amyloid, b-amyloid, Precursor, Protein, APP, Secretase, beta, Peptides, β-peptide, beta-peptide, 1-40, (rat), amyloidbeta, amyloidb, amyloidβ, Beta, 2424, Tocris Bioscience

Citations for Amyloid β-peptide (1-40) (rat)

Citations are publications that use Tocris products.

Currently there are no citations for Amyloid β-peptide (1-40) (rat).

Reviews for Amyloid β-peptide (1-40) (rat)

There are currently no reviews for this product. Be the first to review Amyloid β-peptide (1-40) (rat) and earn rewards!

Have you used Amyloid β-peptide (1-40) (rat)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Alzheimer's Disease Poster

Alzheimer's Disease Poster

Alzheimer's disease (AD) is a debilitating and progressive neurodegenerative disease and the most common cause of dementia, affecting approximately 30% of individuals aged over 85 years. This poster summarizes the cellular and molecular mechanisms of AD.