Apelin-36 (rat, mouse)

Discontinued Product

2427 has been discontinued.

View all Apelin Receptors products.
Description: Endogenous apelin agonist
Datasheet
Citations
Reviews

Biological Activity for Apelin-36 (rat, mouse)

Apelin-36 (rat, mouse) is an endogenous APJ receptor agonist that is secreted by adipocytes. Binds with high affinity to APJ receptors (IC50 = 5.4 nM) and potently inhibits cAMP production in vitro (EC50 = 0.52 nM). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.

Technical Data for Apelin-36 (rat, mouse)

M. Wt 4200.93
Formula C185H304N68O43S
Sequence LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF
Storage Desiccate at -20°C
CAS Number 230299-95-3
PubChem ID 90488763
InChI Key NRXGOOSANFUBIE-ZINMNJNTSA-N
Smiles [H]N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for Apelin-36 (rat, mouse)

Certificate of Analysis / Product Datasheet
Select another batch:

References for Apelin-36 (rat, mouse)

References are publications that support the biological activity of the product.

Zou et al (2000) Apelin peptides block the entry of human immunodeficiency virus (HIV). FEBS Lett. 473 15 PMID: 10802050

Kawamata et al (2001) Molecular properties of apelin: tissue distribution and receptor binding. Biochim.Biophys.Acta 1538 162 PMID: 11336787

Tatemoto et al (1998) Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem.Biophys.Res.Comm. 251 471

View Related Products by Product Action

View all Apelin Receptor Agonists

Keywords: Apelin-36 (rat, mouse), Apelin-36 (rat, mouse) supplier, Endogenous, APJ, receptors, agonists, Apelin, adipokines, Receptors, 2427, Tocris Bioscience

Citations for Apelin-36 (rat, mouse)

Citations are publications that use Tocris products.

Currently there are no citations for Apelin-36 (rat, mouse).

Reviews for Apelin-36 (rat, mouse)

There are currently no reviews for this product. Be the first to review Apelin-36 (rat, mouse) and earn rewards!

Have you used Apelin-36 (rat, mouse)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review