Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewCalcitonin (salmon)
Description: Affects bone formation and resorption
Purity: ≥95% (HPLC)
Biological Activity for Calcitonin (salmon)
Stimulates bone formation by osteoblasts and inhibits bone resorption.
Technical Data for Calcitonin (salmon)
| M. Wt | 3431.9 |
| Formula | C145H240N44O48S2 |
| Sequence |
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP (Modifications: Disulfide bridge: 1-7, Pro-32 = C-terminal amide) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 47931-85-1 |
| PubChem ID | 16133812 |
| InChI Key | BBBFJLBPOGFECG-VJVYQDLKSA-N |
| Smiles | [H]N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC1=O)[C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for Calcitonin (salmon)
| Solubility | Soluble to 1 mg/ml in water |
Product Datasheets for Calcitonin (salmon)
References for Calcitonin (salmon)
References are publications that support the biological activity of the product.
Poyner (1995) Pharmacology of receptors for calcitonin gene-related peptide and amylin. TiPS 16 424 PMID: 8578616
van Rossum et al (1997) Neuroanatomical localization, pharmacological characterization and functions of CGRP, related peptides and their receptors. Neurosci.Biobehav.Rev. 21 649 PMID: 9353797
If you know of a relevant reference for Calcitonin (salmon), please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: Calcitonin (salmon), Calcitonin (salmon) supplier, bone, formation, resorption, AMY1, AMY2, AMY3, Amylin, CT, Calcitonin, agonist, and, Related, Receptors, 1159, Tocris Bioscience
Citations for Calcitonin (salmon)
Citations are publications that use Tocris products.
Currently there are no citations for Calcitonin (salmon). Do you know of a great paper that uses Calcitonin (salmon) from Tocris? Please let us know.
Reviews for Calcitonin (salmon)
There are currently no reviews for this product. Be the first to review Calcitonin (salmon) and earn rewards!
Have you used Calcitonin (salmon)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Peptides Involved in Appetite Modulation Scientific Review
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.