Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewCART (55-102) (rat) is a cocaine- and amphetamine-regulated transcript (CART) with potent appetite-suppressing activity. Satiety factor; inhibits normal and starvation-induced feeding. Closely related to the actions of leptin and neuropeptide Y; blocks the neuropeptide Y-induced feeding response. Induces anxiety and stress behavior in rodents.
M. Wt | 5259.21 |
Formula | C226H367N65O65S7 |
Sequence |
IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Modifications: Disulfide bridges: 14-32, 20-40, 34-47) |
Storage | Store at -20°C |
Purity | ≥95% (HPLC) |
CAS Number | 209615-79-2 |
PubChem ID | 90488834 |
InChI Key | XXBSYMBQWAWYIX-UHFFFAOYSA-N |
Smiles | [H]N[C@@H]([C@@H](C)CC)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CSSC[C@@H]3NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC3=O)C(=O)N[C@@H](CC(C)C)C(O)=O)NC(=O)[C@H](CC(O)=O)NC2=O)[C@@H](C)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC1=O)C(C)C)[C@@H](C)CC |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility | Soluble to 1 mg/ml in water |
References are publications that support the biological activity of the product.
Thim et al (1998) CART, a new anorectic peptide. Int.J.Biochem.Cell Biol. 30 1281 PMID: 9924797
Ludvigsen et al (2001) Solution structure of the satiety factor, CART, reveals new functionality of a well-known fold. Biochemistry 40 9082 PMID: 11478874
Chaki et al (2003) Cocaine- and amphetamine-regulated transcript peptide produces anxiety-like behavior in rodents. Eur.J.Pharmacol. 464 49 PMID: 12600694
If you know of a relevant reference for CART (55-102) (rat), please let us know.
Keywords: CART (55-102) (rat), CART (55-102) (rat) supplier, CART, rat, peptide, 55-102, satiety, factor, inhibits, feeding, supresses, appetite, Other, Peptide, Receptors, 3337, Tocris Bioscience
Citations are publications that use Tocris products. Selected citations for CART (55-102) (rat) include:
Liu et al (2018) Traumatic stress affects alcohol-drinking behavior through cocaine- and amphetamine-regulated transcript 55-102 in the paraventricular nucleus in rats Mol.Med.Rep. 17 1157 PMID: 29115641
Do you know of a great paper that uses CART (55-102) (rat) from Tocris? Please let us know.
There are currently no reviews for this product. Be the first to review CART (55-102) (rat) and earn rewards!
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.