Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewCART (55-102) (human)
Description: Neuromodulatory neuropeptide fragment; satiety factor
Biological Activity for CART (55-102) (human)
CART (55-102) (human) is a cocaine- and amphetamine-regulated transcript (CART) with potent appetite-suppressing activity. Satiety factor; inhibits normal and starvation-induced feeding. Closely related to the actions of leptin and neuropeptide Y; blocks the neuropeptide Y-induced feeding response.
Technical Data for CART (55-102) (human)
| M. Wt | 5245.18 |
| Formula | C225H365N65O65S7 |
| Sequence |
VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Modifications: Disulfide bridge between 14 - 32, 20 - 40, 34 - 47) |
| Storage | Store at -20°C |
| CAS Number | 214050-22-3 |
| PubChem ID | 16132341 |
| InChI Key | UGPMCIBIHRSCBV-XNBOLLIBSA-N |
| Smiles | [H]N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CSSC[C@@H]3NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC3=O)C(=O)N[C@@H](CC(C)C)C(O)=O)NC(=O)[C@H](CC(O)=O)NC2=O)[C@@H](C)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC1=O)C(C)C)[C@@H](C)CC |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for CART (55-102) (human)
References for CART (55-102) (human)
References are publications that support the biological activity of the product.
Thim et al (1998) CART, a new anorectic peptide. Int.J.Biochem.Cell Biol. 30 1281 PMID: 9924797
Ludvigsen et al (2001) Solution structure of the satiety factor, CART, reveals new functionality of a well-known fold. Biochemistry 40 9082 PMID: 11478874
View Related Products by Target
Keywords: CART (55-102) (human), CART (55-102) (human) supplier, CART, human, peptide, fragment, 55-102, neuromodulator, satiety, factor, inhibits, feeding, Other, Peptide, Receptors, 3338, Tocris Bioscience
Citations for CART (55-102) (human)
Citations are publications that use Tocris products.
Currently there are no citations for CART (55-102) (human).
Reviews for CART (55-102) (human)
There are currently no reviews for this product. Be the first to review CART (55-102) (human) and earn rewards!
Have you used CART (55-102) (human)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Peptides Involved in Appetite Modulation Scientific Review
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.