Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewBrain natriuretic peptide (1-32) (human)
Description: Endogenous peptide agonist at ANP receptor A (NPR1)
Purity: ≥95% (HPLC)
Biological Activity
Brain natriuretic peptide (1-32) (human) is an endogenous peptide secreted from cardiac ventricles in response to volume increase and pressure overload that acts as an agonist at atrial natriuretic peptide (ANP) receptor A (NRP1). Decreases de novo collagen synthesis and increases MMP gene expression in vitro. Exhibits natriuretic, vasodilatory and lusitropic activity and inhibits the sympathetic and renin-angiotensin-aldosterone systems in vivo.
Technical Data
| M. Wt | 3464.05 |
| Formula | C143H244N50O42S4 |
| Sequence |
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Modification: Disulfide bridge: 10-26) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 124584-08-3 |
| PubChem ID | 53325981 |
| InChI Key | HPNRHPKXQZSDFX-OAQDCNSJSA-N |
| Smiles | [H]N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@H]1CSSC[C@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC2=CC=CC=C2)NC1=O)[C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data
| Solubility | Soluble to 0.10 mg/ml in water |
Product Datasheets
References
References are publications that support the biological activity of the product.
Tsuruda et al (2002) Brain natriuretic peptide is produced in cardiac fibroblasts and induces matrix metalloproteinases. Circ.Res. 91 1127 PMID: 12480813
Wellard et al (2006) Natriuretic peptides, but not nitric oxide donors, elevate levels of cytosolic guanosine 3',5'-cyclic monophosphate in ependymal cells ex vivo. Neurosci.Lett. 392 187 PMID: 16278044
Heublein et al (2007) Immunoreactivity and guanosine 3',5'-cyclic monophosphate activating actions of various forms of human B-type natriuretic peptide. Hypertension 49 1114 PMID: 17372040
If you know of a relevant reference for Brain natriuretic peptide (1-32) (human), please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: Brain natriuretic peptide (1-32) (human), Brain natriuretic peptide (1-32) (human) supplier, Endogenous, peptide, agonists, ANP, receptor, A, NRP1, Receptors, Atrial, Natriuretic, Peptide, Receptor, 3522, Tocris Bioscience
1 Citation for Brain natriuretic peptide (1-32) (human)
Citations are publications that use Tocris products. Selected citations for Brain natriuretic peptide (1-32) (human) include:
Wang et al (2017) GDF15 is a heart-derived hormone that regulates body growth. EMBO Mol Med 9 1150 PMID: 28572090
Do you know of a great paper that uses Brain natriuretic peptide (1-32) (human) from Tocris? Please let us know.
Reviews for Brain natriuretic peptide (1-32) (human)
Average Rating: 5 (Based on 1 Review.)
Have you used Brain natriuretic peptide (1-32) (human)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Filter by:
NP in vitro.
By
Anonymous on 08/05/2018
Assay Type: In Vitro
Species: Human
Used in vitro to investigate different roles of NP family members.