Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewCRSP-1
Discontinued Product
3555 has been discontinued.
View all Calcitonin and Related Receptors products.
Description: Endogenous central calcitonin agonist
Alternative Names: Calcitonin receptor-stimulating peptide-1
Biological Activity for CRSP-1
CRSP-1 is an endogenous central calcitonin (CT) receptor agonist that stimulates cAMP formation at a potency 350-fold greater than CT (ED50 values are 0.2 and 71 nM respectively). Displays no activity at calcitonin-gene related peptide (CGRP) and adrenomedullin receptors. Inhibits formation of multinuclear osteoclasts with similar efficacy to CT in vitro. Suppresses food intake and increases body temperature in free-feeding rats, and significantly decreases plasma calcium levels in vivo.
Technical Data for CRSP-1
| M. Wt | 4098.88 |
| Formula | C175H294N54O49S5 |
| Sequence |
SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG (Modifications: Disulfide bridge between 2 - 7, Gly-38 = C-terminal amide) |
| Storage | Store at -20°C |
| CAS Number | 697327-12-1 |
| PubChem ID | 90488857 |
| InChI Key | GZXYZTLKVIEHJD-BDNMSBJBSA-N |
| Smiles | [H]N[C@@H](CO)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC1=O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)NCC(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for CRSP-1
References for CRSP-1
References are publications that support the biological activity of the product.
Katafuchi et al (2003) Calcitonin receptor-stimulating peptide, a new member of the calcitonin gene-related peptide family. Its isolation from porcine brain, structure, tissue distribution, and biological activity. J.Biol.Chem. 278 12046 PMID: 12556539
Sawada et al (2006) Central effects of calcitonin receptor-stimulating peptide-1 on energy homeostasis in rats. Endocrinology 147 2043 PMID: 16410305
Notoya et al (2007) A novel member of the calcitonin gene-related peptide family, calcitonin receptor-stimulating peptide, inhibits the formation and activity of osteoclasts. Eur.J.Pharmacol. 560 234 PMID: 17328890
View Related Products by Target
View Related Products by Product Action
Keywords: CRSP-1, CRSP-1 supplier, Endogenous, central, CT, receptors, calcitonin, agonists, Calcitonin, receptor, stimulating, peptide1, receptor-stimulating, peptide-1, and, Related, Receptors, 3555, Tocris Bioscience
Citations for CRSP-1
Citations are publications that use Tocris products.
Currently there are no citations for CRSP-1.
Reviews for CRSP-1
There are currently no reviews for this product. Be the first to review CRSP-1 and earn rewards!
Have you used CRSP-1?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Peptides Involved in Appetite Modulation Scientific Review
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.