Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewProTx II
Description: Selective NaV1.7 channel blocker
Purity: ≥95% (HPLC)
Biological Activity for ProTx II
ProTx II is a selective NaV1.7 channel blocker. Shifts activation gating positively and decreases current magnitude. Displays 100-fold selectivity over other sodium channel subtypes.
Technical Data for ProTx II
| M. Wt | 3826.59 |
| Formula | C168H250N46O41S8 |
| Sequence |
YCQKWMWTCDSERKCCEGMVCRLWCKKKLW (Modifications: Disulfide bridges: 2-16, 9-21, 15-25) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 484598-36-9 |
| PubChem ID | 118708662 |
| InChI Key | XOAUGYVLRSCGBG-ZJDFQAAZSA-N |
| Smiles | [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC1=O)[C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N3)NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC2=O)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for ProTx II
| Solubility | Soluble to 1 mg/ml in water |
Product Datasheets for ProTx II
References for ProTx II
References are publications that support the biological activity of the product.
Smith et al (2007) Molecular interactions of the gating modifier toxin ProTx-II with NaV 1.5: implied existence of a novel toxin binding site coupled to activation. J.Biol.Chem. 282 12687 PMID: 17339321
Edgerton et al (2008) Evidence for multiple effects of ProTxII on activation gating in NaV 1.5. Toxicon. 52 489 PMID: 18657562
Schmalhofer et al (2008) ProTx-II, a selective inhibitor of NaV 1.7 sodium channels, blocks action potential propagation in nociceptors. Mol.Pharmacol. 74 1476 PMID: 18728100
Xu et al (2019) Structural basis of Nav1.7 inhibition by a gating-modifier spider toxin. Cell. 176 702 PMID: 30661758
If you know of a relevant reference for ProTx II, please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: ProTx II, ProTx II supplier, toxins, voltage, gated, sodium, Na+, channels, NaV1.7, potent, selective, blockers, venoms, Voltage-gated, Sodium, Channels, 4023, Tocris Bioscience
2 Citations for ProTx II
Citations are publications that use Tocris products. Selected citations for ProTx II include:
Shen et al (2019) Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins. Science 363 1303 PMID: 30765606
Li et al (2017) Membrane protein Nav1.7 contributes to the persistent post-surgical pain regulated by p-p65 in dorsal root ganglion (DRG) of SMIR rats model. BMC Anesthesiol 17 150 PMID: 29115943
Do you know of a great paper that uses ProTx II from Tocris? Please let us know.
Reviews for ProTx II
There are currently no reviews for this product. Be the first to review ProTx II and earn rewards!
Have you used ProTx II?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image