Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewBay 55-9837
Description: Potent and selective VPAC2 agonist
Purity: ≥95% (HPLC)
Biological Activity for Bay 55-9837
Bay 55-9837 is a selective VPAC2 receptor agonist (EC50 values are 0.4, 100 and >1000 nM for VPAC2, VPAC1 and PAC1, respectively in a cAMP accumulation assay; IC50 values are 60, 8700 and >10000 nM for VPAC2, VPAC1 and PAC1, respectively in a competition binding assay). Stimulates glucose-dependent insulin secretion in isolated human pancreatic islets. Reduces HIV-1 viral replication and shows cooperative effects when given in conjunction with VPAC1 agonists.
Technical Data for Bay 55-9837
| M. Wt | 3742.29 |
| Formula | C167H270N52O46 |
| Sequence |
HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY (Modifications: Tyr-31 = C-terminal amide) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 463930-25-8 |
| PubChem ID | 72941824 |
| InChI Key | NHMJBXFCQMBYCP-ZBLLYJRDSA-N |
| Smiles | [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for Bay 55-9837
| Solubility | Soluble to 2 mg/ml in water |
Product Datasheets for Bay 55-9837
References for Bay 55-9837
References are publications that support the biological activity of the product.
Tsutsumi et al (2002) A potent and highly selective VPAC2 agonist enhances glucose-induced Ins release and glucose disposal: a potential therapy for type 2 diabetes. Diabetes 51 1453 PMID: 11978642
Clairmont et al (2006) Engineering of a VPAC2 receptor peptide agonist to impart dipeptidyl peptidase IV stability and enhance in vivo glucose disposal. J.Med.Chem. 49 7545 PMID: 17149884
Pan et al (2007) Engineering novel VPAC2-selective agonists with improved stability and glucose-lowering activity in vivo. J.Pharmacol.Exp.Ther. 320 900 PMID: 17110523
Temerozo et al (2013) Macrophage resistance to HIV-1 infection is enhanced by the neuropeptides VIP and PACAP. PLoS ONE 8 67701 PMID: 23818986
If you know of a relevant reference for Bay 55-9837, please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: BAY 55-9837, BAY 55-9837 supplier, Potent, selective, VPAC2, agonists, Vasoactive, Intestinal, Peptide, Receptors, VPAC, VIP, BAY55-9837, HIV, 2711, Tocris Bioscience
5 Citations for Bay 55-9837
Citations are publications that use Tocris products. Selected citations for Bay 55-9837 include:
Valeria et al (2016) A subnanomolar concentration of Pituitary Adenylate Cyclase Activating Polypeptide (PACAP) pre-synaptically modulates glutamatergic transmission in the rat hippocampus acting through acetylcholine Neuroscience 340 551 PMID: 27816700
Pantazopoulos et al (2010) Chronic stimulation of the hypothalamic vasoactive intestinal peptide receptor lengthens circadian period in mice and hamsters. Am J Physiol Regul Integr Comp Physiol 299 R379 PMID: 20463182
Kittikulsuth et al (2023) Vasoactive intestinal peptide blockade suppresses tumor growth by regulating macrophage polarization and function in CT26 tumor-bearing mice Sci Rep 13 927 PMID: 36650220
Hamnett et al (2019) Vasoactive intestinal peptide controls the suprachiasmatic circadian clock network via ERK1/2 and DUSP4 signalling. Nat Commun 10 542 PMID: 30710088
Toda and Huganir (2015) Regulation of AMPA receptor phosphorylation by the neuropeptide PACAP38. Purinergic Signal 112 6712 PMID: 25964356
Do you know of a great paper that uses Bay 55-9837 from Tocris? Please let us know.
Reviews for Bay 55-9837
There are currently no reviews for this product. Be the first to review Bay 55-9837 and earn rewards!
Have you used Bay 55-9837?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image