Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewPeptide YY (3-36)
Description: Selective NPY Y2 receptor agonist
Alternative Names: PYY 3-36
Purity: ≥95% (HPLC)
Biological Activity for Peptide YY (3-36)
Peptide YY (3-36) is a Y2 selective agonist. IC50 values are 0.11 and 1050 nM for inhibition of 125I-PYY binding to Y2 and Y1 receptors respectively. Inhibits food intake and reduces weight gain in vivo. Brain penetrant.
Technical Data for Peptide YY (3-36)
| M. Wt | 3980.4 |
| Formula | C176H272N52O54 |
| Sequence |
AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY (Modifications: Tyr-34 = C-terminal amide) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 126339-09-1 |
| PubChem ID | 90479816 |
| InChI Key | AIYOBVCUSVSXOL-NYGOYQSZSA-N |
| Smiles | [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for Peptide YY (3-36)
| Solubility | Soluble to 1 mg/ml in water |
Product Datasheets for Peptide YY (3-36)
References for Peptide YY (3-36)
References are publications that support the biological activity of the product.
Batterham et al (2002) Gut hormone PYY3-36 physiologically inhibits food intake. Nature 418 650 PMID: 12167864
Keire et al (2000) Primary structures of PYY, [Pro34]PYY and PYY-(3-36) confer different conformations and receptor selectivity. Am.J.Physiol.Gastrointest.Liver Physiol. 279 G126 PMID: 10898754
Nonaka et al (2003) Characterization of blood-brain barrier permeability to PYY3-36 in the mouse. J.Pharmacol.Exp.Ther. 306 948 PMID: 12750431
If you know of a relevant reference for Peptide YY (3-36), please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: Peptide YY (3-36), Peptide YY (3-36) supplier, Selective, Y2, receptor, agonists, Neuropeptide, Y, Receptors, NPY, PeptideYY, (3-36), PYY336, neuropeptides, PYY, 3-36, 1618, Tocris Bioscience
1 Citation for Peptide YY (3-36)
Citations are publications that use Tocris products. Selected citations for Peptide YY (3-36) include:
Wu et al (2013) Peptide YY3-36 and 5-hydroxytryptamine mediate emesis induction by trichothecene deoxynivalenol (vomitoxin). Toxicol Sci 133 186 PMID: 23457120
Do you know of a great paper that uses Peptide YY (3-36) from Tocris? Please let us know.
Reviews for Peptide YY (3-36)
There are currently no reviews for this product. Be the first to review Peptide YY (3-36) and earn rewards!
Have you used Peptide YY (3-36)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Peptides Involved in Appetite Modulation Scientific Review
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.