Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewOxyntomodulin (porcine, bovine)
Discontinued Product
2094 has been discontinued.
View all Glucagon-Like Peptide 1 Receptors products.
Description: GLP-1 receptor agonist; endogenous preproglucagon derived peptide; modulates feeding and metabolism
Alternative Names: Glucagon (1-37),Enteroglucagon
Purity: ≥95% (HPLC)
Biological Activity for Oxyntomodulin (porcine, bovine)
Oxyntomodulin (porcine, bovine) is a GLP-1 receptor agonist. Endogenous preproglucagon-derived neuropeptide that modulates feeding and metabolism. Also secreted by intestinal L-cells. Increases cAMP production and inhibits gastric acid secretion in rat stomach. Also weak glucagon receptor agonist.
Technical Data for Oxyntomodulin (porcine, bovine)
| M. Wt | 4421.86 |
| Formula | C192H295N59O60S |
| Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 62340-29-8 |
| PubChem ID | 16144019 |
| InChI Key | PXZWGQLGAKCNKD-DPNMSELWSA-N |
| Smiles | [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for Oxyntomodulin (porcine, bovine)
References for Oxyntomodulin (porcine, bovine)
References are publications that support the biological activity of the product.
Bataille et al (1981) Bioactive enteroglucagon (oxyntomodulin): present knowledge on its chemical structure and its biological activities. Peptides 2 41 PMID: 6283496
Stumpel et al (1997) A new role for enteric glucagon-37: acute stimulation of glucose absorption in rat small intestine. FEBS Lett. 410 515 PMID: 9237694
Jarrousse et al (1985) Oxyntomodulin (glucagon-37) and its C-terminal octapeptide inhibit gastric acid secretion. FEBS Lett. 188 81 PMID: 4018272
Vrang and Larsen et al (2010) Preproglucagon derived peptides GLP-1, GLP-2 and oxyntomodulin in the CNS: role of peripherally secreted and centrally produced peptides. Prog.Neurobiol. 92 442 PMID: 20638440
View Related Products by Target
View Related Products by Product Action
Keywords: Oxyntomodulin (porcine, bovine), Oxyntomodulin (porcine, bovine) supplier, Endogenous, gut, peptide, modulates, feeding, metabolism, GLP1, Receptors, Glucagon-Like, Peptide, 1, Glucagon, agonists, agonism, (1-37), Enteroglucagon, Receptor, 2094, Tocris Bioscience
Citations for Oxyntomodulin (porcine, bovine)
Citations are publications that use Tocris products.
Currently there are no citations for Oxyntomodulin (porcine, bovine).
Reviews for Oxyntomodulin (porcine, bovine)
There are currently no reviews for this product. Be the first to review Oxyntomodulin (porcine, bovine) and earn rewards!
Have you used Oxyntomodulin (porcine, bovine)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Peptides Involved in Appetite Modulation Scientific Review
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.