Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewGLP-1 (7-37)
Description: Endogenous bioactive GLP-1 receptor ligand
Purity: ≥95% (HPLC)
Biological Activity for GLP-1 (7-37)
GLP-1 (7-37) is a endogenous GLP-1 receptor ligand; bioactive and truncated form of GLP-1; insulinotropic hormone.
Technical Data for GLP-1 (7-37)
| M. Wt | 3355.71 |
| Formula | C151H228N40O47 |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 106612-94-6 |
| PubChem ID | 16133830 |
| InChI Key | GCYXWQUSHADNBF-AAEALURTSA-N |
| Smiles | [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for GLP-1 (7-37)
| Solubility | Soluble to 1 mg/ml in water |
Product Datasheets for GLP-1 (7-37)
References for GLP-1 (7-37)
References are publications that support the biological activity of the product.
Marchetti et al (2012) A local glucagon-like peptide 1 (GLP-1) system in human pancreatic islets. Diabetologia 55 3262 PMID: 22965295
Ban et al (2010) Glucagon-like peptide (GLP)-1(9-36)amide-mediated cytoprotection is blocked by exendin(9-39) yet does not require the known GLP-1 receptor. Endocrinology 151 1520 PMID: 20172966
If you know of a relevant reference for GLP-1 (7-37), please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: GLP-1 (7-37), GLP-1 (7-37) supplier, Endogenous, GLP-1, receptor, ligands, bioactive, truncated, form, Glucagon, like, peptide, insulinotropic, proglucagon, agonists, Glucagon-Like, Peptide, 1, Receptors, 5374, Tocris Bioscience
Citations for GLP-1 (7-37)
Citations are publications that use Tocris products.
Currently there are no citations for GLP-1 (7-37). Do you know of a great paper that uses GLP-1 (7-37) from Tocris? Please let us know.
Reviews for GLP-1 (7-37)
There are currently no reviews for this product. Be the first to review GLP-1 (7-37) and earn rewards!
Have you used GLP-1 (7-37)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Peptides Involved in Appetite Modulation Scientific Review
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.