GLP-2 (3-33)

Pricing Availability   Qty
Description: Peptide antagonist of glucagon-like peptide-2 (GLP-2) receptor
Purity: ≥90% (HPLC)
Datasheet
Citations
Reviews
Literature (1)

Biological Activity for GLP-2 (3-33)

GLP-2(3-33) is a peptide antagonist of glucagon-like peptide-2 (GLP-2) receptor. In cells, GLP-2(3-33) is generated by cleaving off the two N-terminal amino acids of GLP-2 with dipeptidylpeptidase IV (DPPIV). In high-fat diet (HFD) fed mice, GLP-2(3-33) treatment results in increased dyslipidemia and hepatic lipid accumulation. Chronic treatment of GLP-2(3-33) in HFD fed mice can cause hyperglycemia, glucose intolerance, high plasma insulin level after glucose load, increased pancreas weight and β-cell expansion.

Technical Data for GLP-2 (3-33)

M. Wt 3557.93
Formula C156H242N40O53S
Sequence DGSFSDEMNTILDNLAARDFINWLIQTKITD
Storage Store at -20°C
Purity ≥90% (HPLC)
CAS Number 275801-62-2
PubChem ID 71455345
InChI Key MYKFSDGCGNRIEA-KXTJMAPWSA-N
Smiles O=C(NCC(N[C@@H](CO)C(N[C@@H](CC1=CC=CC=C1)C(N[C@@H](CO)C(N[C@@H](CC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCSC)C(N[C@@H](CC(N)=O)C(N[C@@H]([C@H](O)C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC(C)C)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(N)=O)C(N[C@@H](CC(C)C)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(O)=O)C(N[C@@H](CC2=CC=CC=C2)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC(N)=O)C(N[C@@H](CC3=CNC4=CC=CC=C34)C(N[C@@H](CC(C)C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCC(N)=O)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCCCN)C(N[C@@H]([C@@H](C)CC)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(O)=O)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC(O)=O)N

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for GLP-2 (3-33)

Solubility Soluble to 2 mg/ml in 0.01M PBS

References for GLP-2 (3-33)

References are publications that support the biological activity of the product.

Baldassano et al (2015) GLP-2 involvement as a beneficial factor in the glucose homeostasis in mice fed a high fat diet. J.Cell Physiol. 230 3029 PMID: 25967277

Baldassano et al (2016) Influence of endogenous glucagon-like peptide-2 on lipid disorders in mice fed a high-fat diet. Endocr.Res. 41 317 PMID: 26906293


If you know of a relevant reference for GLP-2 (3-33), please let us know.

View Related Products by Product Action

View all Glucagon-Like Peptide 2 Receptor Antagonists

Keywords: GLP-2 (3-33), GLP-2 (3-33) supplier, GLP2(3-33), peptide, antagonist, glucagon-like, peptide-2, GLP-2, receptor, lipid, disorders, Glucose, Homeostasis, Glucagon-Like, Peptide, 2, Receptors, 7725, Tocris Bioscience

Citations for GLP-2 (3-33)

Citations are publications that use Tocris products.

Currently there are no citations for GLP-2 (3-33). Do you know of a great paper that uses GLP-2 (3-33) from Tocris? Please let us know.

Reviews for GLP-2 (3-33)

There are currently no reviews for this product. Be the first to review GLP-2 (3-33) and earn rewards!

Have you used GLP-2 (3-33)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.