Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewGLP-2 (rat)
Discontinued Product
2259 has been discontinued.
View all Glucagon-Like Peptide 2 Receptors products.
Description: Endogenous hormone; displays intestinotrophic activity
Alternative Names: Glucagon-like peptide 2 (rat)
Biological Activity for GLP-2 (rat)
GLP-2 (rat) is an endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on gastrointestinal function including regulation of intestinal glucose transport, food intake, and gastric acid secretion.
GLP-2 (human) also available.
Technical Data for GLP-2 (rat)
| M. Wt | 3796.17 |
| Formula | C166H256N44O56S |
| Sequence | HADGSFSDEMNTILDNLATRDFINWLIQTKITD |
| Storage | Desiccate at -20°C |
| CAS Number | 195262-56-7 |
| PubChem ID | 90488760 |
| InChI Key | KBNPAOMRSZGNFV-XBBCIFKHSA-N |
| Smiles | [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for GLP-2 (rat)
References for GLP-2 (rat)
References are publications that support the biological activity of the product.
Rocha et al (2004) Glucagon-like peptide-2: divergent signalling pathways. J.Surg.Res. 121 5 PMID: 15313368
Brubaker and Drucker (2004) Glucagon-like peptides regulate cell proliferation and apoptosis in the pancreas, gut, and central nervous system. Endocrinol. 145 2653
Bulut et al (2004) Glucagon-like peptide 2 improves intestinal wound healing through induction of epithelial cell migration in vitro-evidence for a TGF-β-mediated effect. Reg.Peptides 121 137
View Related Products by Target
Keywords: GLP-2 (rat), GLP-2 (rat) supplier, Endogenous, hormone, displays, intestinotrophic, activity, GLP2, Receptors, Glucagon-Like, Peptide, 2, peptide2, (rat), Glucagon-like, peptide, 2259, Tocris Bioscience
Citations for GLP-2 (rat)
Citations are publications that use Tocris products.
Currently there are no citations for GLP-2 (rat).
Reviews for GLP-2 (rat)
There are currently no reviews for this product. Be the first to review GLP-2 (rat) and earn rewards!
Have you used GLP-2 (rat)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Peptides Involved in Appetite Modulation Scientific Review
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.