Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewGlucagon-like peptide 1 (1-37) (human, rat) is a pancreatic hormone synthesized by post-translational processing of proglucagon. Unlike truncated forms of GLP-1, it has no effect on food intake in rats and does not enhance pancreatic insulin secretion. However it induces insulin expression in intestinal epithelial cells, which can restore glucose homeostasis when implanted into diabetic mice.
M. Wt | 4169.52 |
Formula | C186H275N51O59 |
Sequence | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
Storage | Store at -20°C |
Purity | ≥95% (HPLC) |
CAS Number | 87805-34-3 |
PubChem ID | 16131070 |
InChI Key | UKVFVQPAANCXIL-FJVFSOETSA-N |
Smiles | [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility | Soluble to 5 mg/ml in water |
References are publications that support the biological activity of the product.
Bell et al (1983) Exon duplication and divergence in the human preproglucagon gene. Nature 304 368 PMID: 6877358
Navarro et al (1996) Colocalization of glucagon-like peptide-1 (GLP-1) receptors, glucose transporter GLUT-2, and glucokinase mRNAs in rat hypothalamic cells: evidence for a role of GLP-1 receptor agonists as an inhibitory signal for food and water intake. J.Neurochem. 67 1982 PMID: 8863504
Suzuki et al (2003) Glucagon-like peptide 1 (1-37) converts intestinal epithelial cells into Ins-producing cells. Proc.Natl.Acad.Sci.USA 100 5034
If you know of a relevant reference for Glucagon-like peptide 1 (1-37) (human, rat), please let us know.
Keywords: Glucagon-like peptide 1 (1-37) (human, rat), Glucagon-like peptide 1 (1-37) (human, rat) supplier, Endogenous, pancreatic, peptide, GLP1, Receptors, Glucagon-Like, Peptide, 1, Glucagon-like, peptide1, (1-37), (human, rat), GLP1(1-37), amide, diabetes, GLP-1, 1851, Tocris Bioscience
Citations are publications that use Tocris products. Selected citations for Glucagon-like peptide 1 (1-37) (human, rat) include:
Zhang et al (2013) The slow afterhyperpolarization: a target of β1-adrenergic signaling in hippocampus-dependent memory retrieval. J Neurosci 33 5006 PMID: 23486971
Do you know of a great paper that uses Glucagon-like peptide 1 (1-37) (human, rat) from Tocris? Please let us know.
There are currently no reviews for this product. Be the first to review Glucagon-like peptide 1 (1-37) (human, rat) and earn rewards!
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.