Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewHuwentoxin XVI
Description: Potent and reversible CaV2.2 blocker
Biological Activity for Huwentoxin XVI
Huwentoxin XVI is a potent and selective N-type Ca2+ channel blocker (IC50 ~ 60 nM); selectively and reversibly blocks N-type Ca2+ channels. Does not block T-type Ca2+ channels, K+ channels or Na+ channels. Exhibits analgesic effects in vivo.
Technical Data for Huwentoxin XVI
| M. Wt | 4437.13 |
| Formula | C196H292N50O56S6 |
| Sequence |
CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK (Modifications: Disulfide bridge: 1-16,8-21,15-36) |
| Storage | Store at -20°C |
| CAS Number | 1600543-88-1 |
| PubChem ID | 90489025 |
| InChI Key | JEUFUDFTZMBKGH-UHFFFAOYSA-N |
| Smiles | [H]N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC4=CNC=N4)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H]4CCCN4C(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H]4CCCN4C(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](NC1=O)[C@@H](C)CC)C(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N3)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CO)NC2=O)C(C)C)[C@@H](C)O)[C@@H](C)CC)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for Huwentoxin XVI
References for Huwentoxin XVI
References are publications that support the biological activity of the product.
Deng et al (2014) Huwentoxin-XVI, an analgesic, highly reversible mammalian N-type calcium channel antagonist from Chinese tarantula Ornithoctonus huwena. Neuropharmacology 79 657 PMID: 24467846
Jiang et al (2010) Venomics of the spider Ornithoctonus huwena based on transcriptomic versus proteomic analysis. Comp.Biochem.Physiol.Part D Genomics Proteomics 5 81 PMID: 20403776
View Related Products by Target
View Related Products by Product Action
Keywords: Huwentoxin XVI, Huwentoxin XVI supplier, Huwentoxin, 16, Potent, selective, N, type, Ca2+, channel, blockers, reversible, analgesics, venoms, Cav2.x, Channels, 5235, Tocris Bioscience
Citations for Huwentoxin XVI
Citations are publications that use Tocris products.
Currently there are no citations for Huwentoxin XVI.
Reviews for Huwentoxin XVI
There are currently no reviews for this product. Be the first to review Huwentoxin XVI and earn rewards!
Have you used Huwentoxin XVI?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image