Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewLL 37
Description: Antimicrobial peptide derivative of human cathelicidin
Purity: ≥95% (HPLC)
Biological Activity for LL 37
LL 37 is an antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. LL 37 reduces SARS-CoV-2 infection by blocking the receptor binding domain of the S1 spike protein (Kd = 11.2 nM) and by binding to ACE2 (Kd = 25.5.nM). LL 37 inhibits SARS-CoV-2 pseudovirion infection (IC50 = 4.74 μg/mL) in vitro and in vivo. Also triggers apoptosis in colon cancer cells. Cell permeable.
Technical Data for LL 37
| M. Wt | 4493.32 |
| Formula | C205H340N60O53 |
| Sequence | [LL-37, 37 aa] |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 154947-66-7 |
| PubChem ID | 16198951 |
| InChI Key | POIUWJQBRNEFGX-XAMSXPGMSA-N |
| Smiles | [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for LL 37
| Solubility | Soluble to 1 mg/ml in water |
Product Datasheets for LL 37
References for LL 37
References are publications that support the biological activity of the product.
Seil et al (2010) Spotlight on human LL-37, an immunomodulatory peptide with promising cell-penetrating properties. Pharmaceuticals 3 3435
Yang et al (2000) LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells. J.Exp.Med. 192 1069 PMID: 11015447
Steinstraesser et al (2014) Skin electroporation of a plasmid encoding hCAP-18/LL-37 host defense peptide promotes wound healing. Mol.Ther. 22 734 PMID: 24394186
Ren et al (2012) Host immune defense peptide LL-37 activates caspase-independent apoptosis and suppresses colon cancer. Cancer Res. 72 6512 PMID: 23100468
Wang et al (2021) Human cathelicidin inhibits SARS-CoV-2 infection: killing two birds with one stone. ACS Infect.Dis. 7 1545 PMID: 33849267
If you know of a relevant reference for LL 37, please let us know.
View Related Products by Target
Keywords: LL 37, LL 37 supplier, LL37, antimicrobial, derivative, cathelicidin, chemotaxis, chemotactic, wound, healing, anticancer, cell, permeable, SARS-CoV-2, S1, spike, protein, ACE2, coronavirus, Miscellaneous, Compounds, Coronavirus, 5213, Tocris Bioscience
3 Citations for LL 37
Citations are publications that use Tocris products. Selected citations for LL 37 include:
Susu M et al (2023) ApoM binds endotoxin contributing to neutralization and clearance by High Density Lipoprotein. Biochem Biophys Rep 34 101445 PMID: 36915826
Liqun et al (2022) HBD-2 binds SARS-CoV-2 RBD and blocks viral entry: Strategy to combat COVID-19. iScience 25 103856 PMID: 35128350
Christian et al (2020) IL-37 Expression Is Downregulated in Lesional Psoriasis Skin. Immunohorizons 4 754-761 PMID: 33239358
Do you know of a great paper that uses LL 37 from Tocris? Please let us know.
Reviews for LL 37
There are currently no reviews for this product. Be the first to review LL 37 and earn rewards!
Have you used LL 37?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image