Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewMambalgin 1 is a selective ASIC1a inhibitor (IC50 values are 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively). Binds to closed/inactive channel. Selective for ASIC1a over ASIC2a, ASIC3, TRPV1, P2X2, 5-HT3, Nav1.8, Cav3.2 and Kv1.2 channels. Increases latency of withdrawal response in mouse tail-flick and paw-flick tests. Analgesic.
M. Wt | 6554.51 |
Formula | C272H429N85O84S10 |
Sequence |
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK (Modifications: Disulfide bridge: 3-19, 12-37, 41-49, 50-55) |
Storage | Store at -20°C |
CAS Number | 1609937-15-6 |
PubChem ID | 121513904 |
InChI Key | JRVGGBDTNREHFW-UHFFFAOYSA-N |
Smiles | [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSC[C@@H]2NC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC3=CNC=N3)NC(=O)[C@H](CSSC[C@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@@H]3CCCN3C(=O)[C@H](CCSC)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC3=CNC=N3)NC(=O)[C@H](CC3=CC=C(O)C=C3)NC2=O)[C@@H](C)O)[C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@H]2CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC2=O)[C@@H](C)O)C(=O)N[C@H]2CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CO)NC2=O)[C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC2=CNC=N2)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC2=CC=C(O)C=C2)NC1=O)C(C)C)C(C)C)[C@@H](C)O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
References are publications that support the biological activity of the product.
Diochot et al (2012) Black mamba venom peptides target acid-sensing ion channels to abolish pain. Nature 490 552 PMID: 23034652
Keywords: Mambalgin 1, Mambalgin 1 supplier, ASIC1a, inhibitors, inhibits, acid, sensing, ion, channels, analgesics, analgesia, venoms, ASIC, 5938, Tocris Bioscience
Citations are publications that use Tocris products.
Currently there are no citations for Mambalgin 1.
There are currently no reviews for this product. Be the first to review Mambalgin 1 and earn rewards!
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image