Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewNocistatin (human)
Description: Human putative counterpart of nocistatin
Biological Activity for Nocistatin (human)
Nocistatin (human) is a human putative counterpart of nocistatin (bovine). Blocks nociceptin-induced allodynia and hyperalgesia.
Technical Data for Nocistatin (human)
| M. Wt | 3561.93 |
| Formula | C149H238N42O53S3 |
| Sequence | MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ |
| Storage | Desiccate at -20°C |
| CAS Number | 212609-11-5 |
| PubChem ID | 90479770 |
| InChI Key | OEZVAQPRAUPWHZ-FBGOCWIPSA-N |
| Smiles | [H]N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for Nocistatin (human)
Certificate of Analysis is currently unavailable on-line.
Please contact Customer Service
Please contact Customer Service
References for Nocistatin (human)
References are publications that support the biological activity of the product.
Minami et al (1998) Anti-nociceptive responses produced by human putative counterpart of nocistatin. Br.J.Pharmacol. 124 1016 PMID: 9720768
Okuda-Ashitaka and Ito (2000) Nocistatin: a novel neuropeptide encoded by the gene for the nociceptin/orphanin FQ precursor. Peptides 21 1101 PMID: 10998544
View Related Products by Target
View Related Products by Product Action
Keywords: Nocistatin (human), Nocistatin (human) supplier, Human, putative, counterpart, nocistatin, Nociceptin, Receptors, ORL1, OP4, NOP, Opioid, antagonists, 1198, Tocris Bioscience
1 Citation for Nocistatin (human)
Citations are publications that use Tocris products. Selected citations for Nocistatin (human) include:
Laudenbach et al (2001) Nociceptin/orphanin FQ exacerbates excitotoxic white-matter lesions in the murine neonatal brain. J Clin Invest 107 457 PMID: 11181645
Reviews for Nocistatin (human)
There are currently no reviews for this product. Be the first to review Nocistatin (human) and earn rewards!
Have you used Nocistatin (human)?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Peptides Involved in Appetite Modulation Scientific Review
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.