OD1

Pricing Availability   Qty
Description: Potent hNav1.4, rNav1.6 and rNav1.7 channel activator
Purity: ≥95% (HPLC)
Datasheet
Citations
Reviews (1)

Biological Activity for OD1

OD1 is a potent rat Nav1.7, human Nav1.4 and rat Nav1.6 channel activator (EC50 values are 7, 10 and 47 nM, respectively). Exhibits minimal activation at mammalian Nav1.2, Nav1.3 and Nav1.5 (EC50 values >3 μM). Inhibits fast inactivation on all channels. Increases peak currents at all voltages and stimulates a persistent Na+ current at hNav1.7 channel. Increases hyperpolarization at Nav1.4 and Nav1.6 channels. Induces spontaneous pain in vivo.

Technical Data for OD1

M. Wt 7206.1
Formula C308H466N90O95S8
Sequence GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR

(Modifications: Disulfide bridges: 13-64, 17-37, 23-47, 27-49, Arg-65 = C-terminal amide)

Storage Store at -20°C
Purity ≥95% (HPLC)
PubChem ID 123773280
InChI Key AGQDOUOEJSDDQH-BJQYWQRQSA-N
Smiles [H]NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@@H]2CCCN2C(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@@H]2CCCN2C(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H]2CCCN2C(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H]2CSSC[C@@H]3NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H]4CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC5=CC=C(O)C=C5)NC(=O)[C@@H](NC1=O)C(C)C)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CC1=CNC5=C1C=CC=C5)NC(=O)[C@H](CCC(N)=O)NC3=O)[C@@H](C)CC)C(=O)N[C@@H](CC1=CNC3=C1C=CC=C3)C(=O)N2)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N4)[C@@H](C)O)[C@@H](C)CC)C(C)C)[C@@H](C)CC)[C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for OD1

Solubility Soluble to 1 mg/ml in water

Product Datasheets for OD1

Certificate of Analysis / Product Datasheet
Select another batch:

References for OD1

References are publications that support the biological activity of the product.

Durek et al (2013) Chemical engineering and structural and pharmacological characterization of the α-scorpion toxin OD1. ACS Chem.Biol. 8 1215 PMID: 23527544

Jalali et al (2005) OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels. FEBS Lett. 579 4181 PMID: 16038905

Maertens et al (2006) Potent modulation of the voltage-gated sodium channel Nav1.7 by OD1, a toxin from the scorpion Odonthobuthus doriae. Mol.Pharmacol. 70 405 PMID: 16641312


If you know of a relevant reference for OD1, please let us know.

View Related Products by Product Action

View all Voltage-gated Sodium (NaV) Channel Activators

Keywords: OD1, OD1 supplier, Potent, Nav1.4,, Nav1.6, and, Nav1.7, activators, activates, pain, nociceptin, receptors, voltage-gated, sodium, channels, venoms, Voltage-gated, Sodium, Channels, 5941, Tocris Bioscience

Citations for OD1

Citations are publications that use Tocris products.

Currently there are no citations for OD1. Do you know of a great paper that uses OD1 from Tocris? Please let us know.

Reviews for OD1

Average Rating: 5 (Based on 1 Review.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used OD1?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


OD1 used to activate rNav1.7.
By Anonymous on 02/12/2019
Species: Human

Our lab used the product on rNav1.7. OD1 potently inhibits fast inactivation of mammalian channels Nav1.7.

review image