Psalmotoxin 1

Pricing Availability   Qty
Description: Potent and selective ASIC1a channel blocker
Alternative Names: PcTx1
Purity: ≥95% (HPLC)
Datasheet
Citations (2)
Reviews

Biological Activity for Psalmotoxin 1

Psalmotoxin 1 is a potent and selective acid-sensing ion channel 1a (ASIC1a) blocker (IC50 = 0.9 nM). Displays no effect at ASIC1b, ASIC2a, ASIC3, heteromeric ASIC channels, ENaC and KV2.1/2.2/4.2/4.3 channels expressed in oocytes, at concentrations up to 100 nM. Displays potent analgesic properties against thermal, mechanical, chemical, inflammatory and neuropathic pain in rodents.

Technical Data for Psalmotoxin 1

M. Wt 4689.41
Formula C200H312N62O57S6
Sequence EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT

(Modifications: Disulfide bridges: 3-18, 10-23, 17-33)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 316808-68-1
PubChem ID 90489000
InChI Key LICLJUGDURFZIM-UHFFFAOYSA-N
Smiles [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CSSC[C@H](NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]4CCCN4C(=O)[C@@H](NC1=O)[C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N3)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC2=O)C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Psalmotoxin 1

Solubility Soluble to 2 mg/ml in water

Product Datasheets for Psalmotoxin 1

Certificate of Analysis / Product Datasheet
Select another batch:

References for Psalmotoxin 1

References are publications that support the biological activity of the product.

Mazzuca et al (2007) A tarantula peptide against pain via ASIC1a channels and opioid mechanisms. Nat.Neurosci. 10 943 PMID: 17632507

Escoubas et al (2000) Isolation of a tarantula toxin specific for a class of proton-gated Na+ channels. J.Biol.Chem. 275 25116 PMID: 10829030

Escoubas et al (2003) Recombinant production and solution structure of PcTx1, the specific peptide inhibitor of ASIC1a proton-gated cation channels. Protein Sci. 12 1332 PMID: 12824480

Salinas et al (2006) The receptor site of the spider toxin PcTx1 on the proton-gated cation channel ASIC1a. J.Physiol. 570 339 PMID: 16284080


If you know of a relevant reference for Psalmotoxin 1, please let us know.

View Related Products by Product Action

View all Acid-Sensing Ion Channel Blockers

Keywords: Psalmotoxin 1, Psalmotoxin 1 supplier, pctx1, acid-sensing, acid, ion, channel, 1a, ASIC1a, ASIC, blockers, analgesic, pain, thermal, mechanical, chemical, inflammatory, neuropathic, venoms, PcTx1, 5042, Tocris Bioscience

2 Citations for Psalmotoxin 1

Citations are publications that use Tocris products. Selected citations for Psalmotoxin 1 include:

Shanchun et al (2021) Regulation of gliomagenesis and stemness through acid sensor ASIC1a. Int J Oncol 59 PMID: 34515325

Chih-Cheng et al (2021) ASIC1a is required for neuronal activation via low-intensity ultrasound stimulation in mouse brain. Elife 10 PMID: 34569932


Do you know of a great paper that uses Psalmotoxin 1 from Tocris? Please let us know.

Reviews for Psalmotoxin 1

There are currently no reviews for this product. Be the first to review Psalmotoxin 1 and earn rewards!

Have you used Psalmotoxin 1?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review