Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit Reviewω-Agatoxin IVA
Description: CaV2.1 blocker
Alternative Names: ω-Aga-IV A
Purity: ≥95% (HPLC)
Biological Activity for ω-Agatoxin IVA
ω-Agatoxin IVA is a selective blocker of P-type calcium channels (IC50 < 1 - 3 nM). Also inhibits N-type channels at micromolar concentrations.
Technical Data for ω-Agatoxin IVA
| M. Wt | 5202.25 |
| Formula | C217H360N68O60S10 |
| Sequence |
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA (Modifications: Disulfide bridges: 4-20, 12-25, 19-36, 27-34) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 145017-83-0 |
| PubChem ID | 56841669 |
| InChI Key | NVVFOMZVLALQKT-JYRRICCISA-N |
| Smiles | [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]4CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC5=CC=C(O)C=C5)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@@H](NC1=O)[C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC5=C1C=CC=C5)C(=O)NCC(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC2=O)[C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N4)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for ω-Agatoxin IVA
| Solubility | Soluble to 1 mg/ml in water |
Product Datasheets for ω-Agatoxin IVA
References for ω-Agatoxin IVA
References are publications that support the biological activity of the product.
Mintz et al (1992) P-type calcium channels blocked by the spider toxin ω-Aga-IVA. Nature 355 827 PMID: 1311418
Turner et al (1992) Calcium channels coupled to glutamate release identified by ω-Aga-IVA. Science 258 310 PMID: 1357749
Bourinet et al (1999) Splicing of α1A subunit gene generates phenotypic variants of P- and Q-type calcium channels. Nat.Neurosci. 2 407 PMID: 10321243
Tringham et al (2008) Protease treatment of cerebellar purkinje cells renders ω-agatoxin IVA-sensitive Ca2+ channels insensitive to inhibition by ω-conotoxin GVIA. J.Pharmacol.Exp.Ther. 324 806 PMID: 17975010
If you know of a relevant reference for ω-Agatoxin IVA, please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: w-Agatoxin IVA, w-Agatoxin IVA supplier, Ca2+, channel, blockers, P-type, Calcium, CaV, Channels, voltage-gated, voltage-dependent, ω-Agatoxin, omega-Agatoxin, IVA, w-AgatoxinIVA, w-Aga-IVA, ω-Aga-IVA, venoms, w-Aga-IV, A, Cav2.x, 2799, Tocris Bioscience
6 Citations for ω-Agatoxin IVA
Citations are publications that use Tocris products. Selected citations for ω-Agatoxin IVA include:
Medrihan et al (2013) Synapsin II desynchronizes neurotransmitter release at inhibitory synapses by interacting with presynaptic calcium channels. Nature 4 1512 PMID: 23443540
Bellono (2017) Molecular basis of ancestral vertebrate electroreception. Nature 543 391 PMID: 28264196
Azad et al (2008) Activation of CB1 specifically located on GABAergic interneurons inhibits LTD in the lateral amygdala. Learn Mem 15 143 PMID: 18323569
Kim et al (2018) Voltage-dependent Ca2+ channels promote branching morphogenesis of salivary glands by patterning differential growth. Sci Rep 8 7566 PMID: 29765108
Jiang et al (2010) The maturation of GABAergic transmission in visual cortex requires endocannabinoid-mediated LTD of inhibitory inputs during a critical period. Neuron 66 248 PMID: 20435001
Higley and Sabatini (2010) Competitive regulation of synaptic Ca2+ influx by D2 DA and A2A adenosine receptors. Nat Neurosci 13 958 PMID: 20601948
Do you know of a great paper that uses ω-Agatoxin IVA from Tocris? Please let us know.
Reviews for ω-Agatoxin IVA
Average Rating: 5 (Based on 1 Review.)
Have you used ω-Agatoxin IVA?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Filter by:
The pharmacological inhibitors for electrophysiology assay.
By
Anonymous on 02/28/2020
Assay Type: In Vitro
Species: Other
The following concentrations we were used:1 μM Bay K, 10 μM nifedipine, 10 μM nimodipine, 300 nM omega -agatoxin, 1 μM omega -conotoxin, 5 μM mibefradil, 1 μM tetrodotoxin, 1 μM charybdotoxin, 100 nM iberiotoxin, 10 μM NS11021.
