Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit Reviewω-Agatoxin TK
Description: CaV2.1 blocker
Alternative Names: Agatoxin IVB
Purity: ≥95% (HPLC)
Biological Activity for ω-Agatoxin TK
ω-Agatoxin TK is a selective blocker of CaV2.1 P/Q-type calcium channels.
Technical Data for ω-Agatoxin TK
| M. Wt | 5273.02 |
| Formula | C215H337N65O70S10 |
| Sequence |
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA (Modifications: Disulfide bridges: 4-20, 12-25, 19-36, 27-34) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 158484-42-5 |
| PubChem ID | 90488781 |
| InChI Key | MBXCGHHUBOKUGG-UHFFFAOYSA-N |
| Smiles | [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]4CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC5=CC=C(O)C=C5)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC1=O)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CNC5=C1C=CC=C5)C(=O)NCC(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N3)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N4)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for ω-Agatoxin TK
| Solubility | Soluble in water |
Product Datasheets for ω-Agatoxin TK
References for ω-Agatoxin TK
References are publications that support the biological activity of the product.
Teramoto et al (1997) A novel type of calcium channel sensitive to ω-agatoxin-TK in cultured rat cerebral cortical neurons. Brain Res. 756 225 PMID: 9187336
Barral et al (2001) High-affinity inhibition of glutamate release from corticostriatal synapses by ω-agatoxin TK. Eur.J.Pharmacol. 430 167 PMID: 11711028
Teramoto et al (1993) A novel peptide from funnel web spider venom, ω-Aga-TK, selectively blocks P-type calcium channels. Biochem.Biophys.Res.Comms. 196 134
If you know of a relevant reference for ω-Agatoxin TK, please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: w-Agatoxin TK, w-Agatoxin TK supplier, Ca2+, channel, blockers, P/Q-type, Calcium, CaV, Channels, P-Type, voltage-gated, voltage-dependent, Omega-Agatoxin, ω-Agatoxin, TK, w-AgatoxinTK, AgatoxinIVB, venoms, Agatoxin, IVB, Cav2.x, 2802, Tocris Bioscience
5 Citations for ω-Agatoxin TK
Citations are publications that use Tocris products. Selected citations for ω-Agatoxin TK include:
Li et al (2011) Concurrent imaging of synaptic vesicle recycling and calcium dynamics. Front Mol Neurosci 4 34 PMID: 22065946
Grubb and Burrone (2010) Activity-dependent relocation of the axon initial segment fine-tunes neuronal excitability. Mol Cell Neurosci 465 1070 PMID: 20543823
Maier et al (2010) Sustained glutamate receptor activation down-regulates GABAB receptors by shifting the balance from recycling to lysosomal degradation. J Biol Chem 285 35606 PMID: 20826795
Fakira et al (2012) Purkinje cell dysfunction and delayed death in plasma membrane calcium ATPase 2-heterozygous mice. J Neurosci 51 22 PMID: 22789621
Cramer et al (2015) Abnormal excitability and episodic low-frequency oscillations in the cerebral cortex of the tottering mouse. Neuropsychopharmacology 35 5664 PMID: 25855180
Do you know of a great paper that uses ω-Agatoxin TK from Tocris? Please let us know.
Reviews for ω-Agatoxin TK
Average Rating: 5 (Based on 1 Review.)
Have you used ω-Agatoxin TK?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Filter by:
Test of VGCCs input into 5HT-1B effect on transmembrane current.
By
Sergiy Sylantyev on 12/10/2023
Assay Type: In Vitro
Species: Mouse
Cell Line/Tissue: Arcuate nucleus
1 μM omega -Agatoxin TK was used as a part of a mixture (also containing 1 μM omega -Conotoxin GVIA and 5 μM R-(+)-Bay-K) which blocks voltage-gated calcium channels in a living neuron membrane. Left: the effect of activation of 5HT-1B and AMPA receptors on transmembrane current evoked upon membrane depolarization. Blue trace: control; red trace: 5HT-1B and AMPA receptors activation. Right: block of VGCCs results in 100% suppression of transmembrane current.
