Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit Review4812 has been discontinued.
View all Voltage-gated Potassium (K<sub>V</sub>) Channels products.ADWX 1 is a potent and selective KV1.3 channel blocker (IC50 values are 0.0019 and 0.65 nM for KV1.3 and KV1.1, respectively). Inhibits CD4+ CCR7- T cell activation. Ameliorates rat experimental autoimmune encephalomyelitis, in a model for multiple sclerosis.
M. Wt | 4071.86 |
Formula | C169H281N57O46S7 |
Sequence |
VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK (Modifications: Disulfide bridge: 7 - 27, 13 - 32, 17 - 34) |
Storage | Store at -20°C |
PubChem ID | 90488974 |
InChI Key | KOXLLJFKLFSCAF-UHFFFAOYSA-N |
Smiles | [H]NC(C(C)C)C(=O)NCC(=O)NC(C(C)CC)C(=O)NC(CC(N)=O)C(=O)NC(C(C)C)C(=O)NC(CCCCN)C(=O)NC1CSSCC2NC(=O)C(CCCCN)NC(=O)CNC(=O)C(CC3=CC=CC=C3)NC(=O)C(CCCNC(N)=N)NC(=O)C(CCSC)NC(=O)CNC(=O)C(C)NC(=O)C(CC(O)=O)NC(=O)C(CCCCN)NC(=O)C3CSSCC(NC(=O)C(CC4=CNC=N4)NC(=O)C(CSSCC(NC(=O)C(CCC(N)=O)NC(=O)C(CCCNC(N)=N)NC(=O)C(CO)NC(=O)C(CC4=CNC=N4)NC(=O)C(CCCCN)NC1=O)C(=O)NC(CC(C)C)C(=O)NC(CCCCN)C(=O)N1CCCC1C(=O)N3)NC(=O)C(CCCCN)NC(=O)CNC(=O)C(CC(N)=O)NC(=O)C(NC2=O)C(C)O)C(=O)NC(C(C)O)C(=O)N1CCCC1C(=O)NC(CCCCN)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
References are publications that support the biological activity of the product.
Han et al (2008) Structural basis of a potent peptide inhibitor designed for KV1.3 channel, a therapeutic target of autoimmune disease. J.Biol.Chem. 283 19058 PMID: 18480054
Li et al (2012) Selective inhibition of CCR7(-) effector memory T cell activation by a novel peptide targeting Kv1.3 channel in a rat experimental autoimmune encephalomyelitis model. J.Biol.Chem. 287 29479 PMID: 22761436
Keywords: ADWX 1, ADWX 1 supplier, ADWX1, KV1.3, potassium, channels, blockers, CD4+, CCR7-, T-cell, autoimmune, encephalomyelitis, multiple, sclerosis., Voltage-Gated, Potassium, Channels, 4812, Tocris Bioscience
Citations are publications that use Tocris products.
Currently there are no citations for ADWX 1.
Average Rating: 5 (Based on 1 Review.)
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Filter by:
Product was used on KV1.1 channels to measure the percentage blocking action exhibited against increasing concentration. Concentration action relation was studied on various cell lines expressing Kv 1.1 channels to understand the differences.