Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewADWX 1
Discontinued Product
4812 has been discontinued.
View all Voltage-gated Potassium (K<sub>V</sub>) Channels products.
Description: Potent and selective KV1.3 channel blocker
Biological Activity for ADWX 1
ADWX 1 is a potent and selective KV1.3 channel blocker (IC50 values are 0.0019 and 0.65 nM for KV1.3 and KV1.1, respectively). Inhibits CD4+ CCR7- T cell activation. Ameliorates rat experimental autoimmune encephalomyelitis, in a model for multiple sclerosis.
Technical Data for ADWX 1
| M. Wt | 4071.86 |
| Formula | C169H281N57O46S7 |
| Sequence |
VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK (Modifications: Disulfide bridge: 7 - 27, 13 - 32, 17 - 34) |
| Storage | Store at -20°C |
| PubChem ID | 90488974 |
| InChI Key | KOXLLJFKLFSCAF-UHFFFAOYSA-N |
| Smiles | [H]NC(C(C)C)C(=O)NCC(=O)NC(C(C)CC)C(=O)NC(CC(N)=O)C(=O)NC(C(C)C)C(=O)NC(CCCCN)C(=O)NC1CSSCC2NC(=O)C(CCCCN)NC(=O)CNC(=O)C(CC3=CC=CC=C3)NC(=O)C(CCCNC(N)=N)NC(=O)C(CCSC)NC(=O)CNC(=O)C(C)NC(=O)C(CC(O)=O)NC(=O)C(CCCCN)NC(=O)C3CSSCC(NC(=O)C(CC4=CNC=N4)NC(=O)C(CSSCC(NC(=O)C(CCC(N)=O)NC(=O)C(CCCNC(N)=N)NC(=O)C(CO)NC(=O)C(CC4=CNC=N4)NC(=O)C(CCCCN)NC1=O)C(=O)NC(CC(C)C)C(=O)NC(CCCCN)C(=O)N1CCCC1C(=O)N3)NC(=O)C(CCCCN)NC(=O)CNC(=O)C(CC(N)=O)NC(=O)C(NC2=O)C(C)O)C(=O)NC(C(C)O)C(=O)N1CCCC1C(=O)NC(CCCCN)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for ADWX 1
References for ADWX 1
References are publications that support the biological activity of the product.
Han et al (2008) Structural basis of a potent peptide inhibitor designed for KV1.3 channel, a therapeutic target of autoimmune disease. J.Biol.Chem. 283 19058 PMID: 18480054
Li et al (2012) Selective inhibition of CCR7(-) effector memory T cell activation by a novel peptide targeting Kv1.3 channel in a rat experimental autoimmune encephalomyelitis model. J.Biol.Chem. 287 29479 PMID: 22761436
View Related Products by Target
View Related Products by Product Action
Keywords: ADWX 1, ADWX 1 supplier, ADWX1, KV1.3, potassium, channels, blockers, CD4+, CCR7-, T-cell, autoimmune, encephalomyelitis, multiple, sclerosis., Voltage-Gated, Potassium, Channels, 4812, Tocris Bioscience
Citations for ADWX 1
Citations are publications that use Tocris products.
Currently there are no citations for ADWX 1.
Reviews for ADWX 1
Average Rating: 5 (Based on 1 Review.)
Have you used ADWX 1?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Filter by:
Product was used on KV1.1 channels on increasing concentrations.
By
Anonymous on 12/21/2018
Species: Human
Product was used on KV1.1 channels to measure the percentage blocking action exhibited against increasing concentration. Concentration action relation was studied on various cell lines expressing Kv 1.1 channels to understand the differences.
