Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewAgitoxin 2
Discontinued Product
5195 has been discontinued.
View all Voltage-gated Potassium (K<sub>V</sub>) Channels products.
Description: Potent Shaker K+ channel blocker
Biological Activity for Agitoxin 2
Agitoxin 2 is a potent Shaker K+ channel blocker (Ki = 0.64 nM). Also inhibits Kv1.3, Kv1.6 and Kv1.1 K+ channels (Ki values are 4, 37 and 44 pM respectively).
Technical Data for Agitoxin 2
| M. Wt | 4090.87 |
| Formula | C169H278N54O48S8 |
| Sequence |
GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK (Modifications: Disulfide bridge: 8-28,14-33,18-35) |
| Storage | Store at -20°C |
| CAS Number | 168147-41-9 |
| PubChem ID | 90489022 |
| InChI Key | MNSSWZUIQUJZTG-UHFFFAOYSA-N |
| Smiles | [H]NCC(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCSC)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC=N4)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CO)NC(=O)CNC(=O)[C@@H](NC1=O)[C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC2=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for Agitoxin 2
References for Agitoxin 2
References are publications that support the biological activity of the product.
Garcia et al (1994) Purification and characterization of three inhibitors of voltage-dependent K+ channels from Leiurus quinquestriatus var. hebraeus venom. Biochemistry 33 6834 PMID: 8204618
Anangi et al (2012) Recombinant expression of margatoxin and agitoxin-2 in Pichia pastoris: an efficient method for production of KV1.3 channel blockers. PLoS ONE 7 e52965 PMID: 23300835
Gross et al (1996) Agitoxin footprinting the shaker potassium channel pore. Neuron 16 399 PMID: 8789954
View Related Products by Target
View Related Products by Product Action
Keywords: Agitoxin 2, Agitoxin 2 supplier, potent, shaker, potassium, K+, channels, blockers, inhibits, inhibitors, Kv1.4, kv1.1, kv1.3, kv1.6, voltage, gated, venoms, Voltage-Gated, Potassium, Channels, 5195, Tocris Bioscience
Citations for Agitoxin 2
Citations are publications that use Tocris products.
Currently there are no citations for Agitoxin 2.
Reviews for Agitoxin 2
Average Rating: 5 (Based on 1 Review.)
Have you used Agitoxin 2?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Filter by:
Agitoxin 2 was used on Kv1.3 channels.
By
Anonymous on 02/12/2019
Species: Human
Agitoxin 2 was used on Kv1.3 channels. The percentage blocking against increasing concentration of Agitoxin 2 was measured.
