Home / Pharmacology / GPCRs / 7-TM Receptors / Peptide Receptors / VIP Receptors / VIP Receptor Agonists / [Ala11,22,28]VIP

[Ala11,22,28]VIP

Cat. No. 1386 Submit a Review Datasheet / COA / SDS

Discontinued Product

1386 has been discontinued.

View all VIP Receptors products.
Description: Potent, highly selective VPAC1 agonist
Datasheet
Citations
Reviews
Biological Activity Technical Data Datasheets References

Biological Activity for [Ala11,22,28]VIP

Potent and highly selective agonist for the human VPAC1 receptor (Ki values are 7.4 and 2352 nM for binding to human recombinant VPAC1 and VPAC2 receptors respectively).

Technical Data for [Ala11,22,28]VIP

M. Wt 3160.68
Formula C139H231N43O39S
Sequence HSDAVFTDNYARLRKQMAVKKALNSILA-NH2
Storage Desiccate at -20°C
CAS Number 291524-04-4
Smiles [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for [Ala11,22,28]VIP

Certificate of Analysis / Product Datasheet
Select another batch:
Safety Datasheet

References for [Ala11,22,28]VIP

References are publications that support the biological activity of the product.

Nicole et al (2000) Identification of key residues for interaction of vasoactive intestinal peptide with human VPAC1 and VPAC2 receptors and development of a highly selective VPAC1 agonist. J.Biol.Chem. 275 24003 PMID: 10801840

View Related Products by Target

View Related Products by Product Action

View all VIP Receptor Agonists

Keywords: [Ala11,22,28]VIP, [Ala11,22,28]VIP supplier, Potent, selective, VPAC1, agonists, Vasoactive, Intestinal, Peptide, Receptors, VPAC, VIP, 1386, Tocris Bioscience

Citations for [Ala11,22,28]VIP

Citations are publications that use Tocris products.

Currently there are no citations for [Ala11,22,28]VIP.

Reviews for [Ala11,22,28]VIP

There are currently no reviews for this product. Be the first to review [Ala11,22,28]VIP and earn rewards!

Have you used [Ala11,22,28]VIP?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review