Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewAmyloid β-Peptide (1-43) (human)
Discontinued Product
1938 has been discontinued.
Description: Amyloid β-protein fragment
Biological Activity for Amyloid β-Peptide (1-43) (human)
Amyloid β-Peptide (1-43) (human) is a human β-amyloid peptide; minor component of neuritic plaques found in brains of patients with Alzheimer's disease.
Technical Data for Amyloid β-Peptide (1-43) (human)
| M. Wt | 4615.19 |
| Formula | C207H318N56O62S |
| Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT |
| Storage | Desiccate at -20°C |
| CAS Number | 134500-80-4 |
| PubChem ID | 90488728 |
| InChI Key | YQWMUHTZOOEROI-ASYIRXGMSA-N |
| Smiles | [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for Amyloid β-Peptide (1-43) (human)
References for Amyloid β-Peptide (1-43) (human)
References are publications that support the biological activity of the product.
Hilbich et al (1991) Human and rodent sequence analogs of Alzheimer's amyloid βA4 share similar properties and can be solubilized in buffers of pH 7.4. Eur.J.Biochem. 201 61 PMID: 1915378
Jarrett et al (1993) The carboxy terminus of the β amyloid protein is critical for the seeding of amyloid formation: implications for the pathogenesis of Alzheimer's disease. Biochemistry 32 4693 PMID: 8490014
Mori et al (1992) Mass spectrometry of purified amyloid β protein in Alzheimer's disease. J.Biol.Chem. 267 17082 PMID: 1512246
View Related Products by Target
Keywords: Amyloid beta-peptide (1-43) (human), Amyloid beta-peptide (1-43) (human) supplier, Amyloid, β-protein, beta-protein, fragment, β-Amyloid, beta-Amyloid, b-amyloid, Precursor, Protein, APP, Secretase, β-peptide, beta-peptide, (1-43), (human), amyloidbeta, amyloidb, Beta, Peptides, 1938, Tocris Bioscience
Citations for Amyloid β-Peptide (1-43) (human)
Citations are publications that use Tocris products.
Currently there are no citations for Amyloid β-Peptide (1-43) (human).
Reviews for Amyloid β-Peptide (1-43) (human)
There are currently no reviews for this product. Be the first to review Amyloid β-Peptide (1-43) (human) and earn rewards!
Have you used Amyloid β-Peptide (1-43) (human)?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Alzheimer's Disease Poster
Alzheimer's disease (AD) is a debilitating and progressive neurodegenerative disease and the most common cause of dementia, affecting approximately 30% of individuals aged over 85 years. This poster summarizes the cellular and molecular mechanisms of AD.