Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewBDS I
Discontinued Product
5184 has been discontinued.
View all Voltage-gated Potassium (K<sub>V</sub>) Channels products.
Description: Potent and reversible Kv3.4 potassium channel blocker; neuroprotective
Alternative Names: Blood depressing substance 1
Biological Activity for BDS I
BDS I is a potent and reversible Kv3.4 potassium channel blocker (IC50 = 47 nM); also attenuates inactivation of sodium currents by acting on Nav1.7 and Nav1.3 channels. Enhances TTX-sensitive sodium currents in rat small dorsal root ganglion neurons. Neuroprotective.
Technical Data for BDS I
| M. Wt | 4708.37 |
| Formula | C210H297N57O56S6 |
| Sequence |
AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH (Modifications: Disulfide bridge: 4-39,6-32,22-40) |
| Storage | Store at -20°C |
| PubChem ID | 90489021 |
| InChI Key | NHDQBZJQNKDJOQ-UHFFFAOYSA-N |
| Smiles | [H]N[C@@H](C)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]3CCCN3C(=O)[C@H](CC3=CNC4=C3C=CC=C4)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CC=CC=C4)NC1=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC4=C1C=CC=C4)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CSSC[C@H](NC2=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(O)=O)C(=O)N1CCC[C@H]1C(=O)NCC(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N3)[C@@H](C)CC |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for BDS I
References for BDS I
References are publications that support the biological activity of the product.
Diochot et al (1998) Sea anemone peptides with a specific blocking activity against the fast inactivating potassium channel Kv3.4. J.Biol.Chem. 273 6744 PMID: 9506974
Liu et al (2012) Modulation of neuronal sodium channels by the sea anemone peptide BDS-I. J.Neurophysiol. 107 3155 PMID: 22442564
Pannaccione et al (2007) Up-regulation and increased activity of KV3.4 channels and their accessory subunit MinK-related peptide 2 induced by amyloid peptide are involved in apoptotic neuronal death. Mol.Pharmacol. 72 665 PMID: 17495071
View Related Products by Target
View Related Products by Product Action
Keywords: BDS I, BDS I supplier, BDSI, blood, depressing, substance, 1, potent, reversible, Kv3.4, potassium, channels, blockers, attenuated, inactivation, sodium, currents, Nav1.7, and, Nav1.3, neuroprotective, venoms, BDS1, BDS, BDS-1, Blood, Voltage-Gated, Potassium, Channels, Voltage-gated, Sodium, 5184, Tocris Bioscience
Citations for BDS I
Citations are publications that use Tocris products.
Currently there are no citations for BDS I.
Reviews for BDS I
Average Rating: 5 (Based on 1 Review.)
Have you used BDS I?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Filter by:
Great water soluble toxin for Kv blocking.
By
Anonymous on 10/22/2018
Assay Type: In Vitro
Species: Human
BDS I toxin is stable, water soluble and thus a suitable choice in Kv3.4 channel activity monitoring.The product worked ideally and gave similar data patterns every single time.
