Calcitonin (salmon)

Pricing Availability   Qty
Description: Affects bone formation and resorption
Purity: ≥95% (HPLC)
Datasheet
Citations
Reviews
Literature (1)

Biological Activity for Calcitonin (salmon)

Stimulates bone formation by osteoblasts and inhibits bone resorption.

Technical Data for Calcitonin (salmon)

M. Wt 3431.9
Formula C145H240N44O48S2
Sequence CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP

(Modifications: Disulfide bridge: 1-7, Pro-32 = C-terminal amide)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 47931-85-1
PubChem ID 16133812
InChI Key BBBFJLBPOGFECG-VJVYQDLKSA-N
Smiles [H]N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC1=O)[C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Calcitonin (salmon)

Solubility Soluble to 1 mg/ml in water

Product Datasheets for Calcitonin (salmon)

Certificate of Analysis / Product Datasheet
Select another batch:

References for Calcitonin (salmon)

References are publications that support the biological activity of the product.

Poyner (1995) Pharmacology of receptors for calcitonin gene-related peptide and amylin. TiPS 16 424 PMID: 8578616

van Rossum et al (1997) Neuroanatomical localization, pharmacological characterization and functions of CGRP, related peptides and their receptors. Neurosci.Biobehav.Rev. 21 649 PMID: 9353797


If you know of a relevant reference for Calcitonin (salmon), please let us know.

View Related Products by Product Action

View all Calcitonin and Related Receptor Agonists

Keywords: Calcitonin (salmon), Calcitonin (salmon) supplier, bone, formation, resorption, AMY1, AMY2, AMY3, Amylin, CT, Calcitonin, agonist, and, Related, Receptors, 1159, Tocris Bioscience

Citations for Calcitonin (salmon)

Citations are publications that use Tocris products.

Currently there are no citations for Calcitonin (salmon). Do you know of a great paper that uses Calcitonin (salmon) from Tocris? Please let us know.

Reviews for Calcitonin (salmon)

There are currently no reviews for this product. Be the first to review Calcitonin (salmon) and earn rewards!

Have you used Calcitonin (salmon)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.