Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewGalanin (1-30) (human)
Description: Endogenous galanin receptor agonist
Purity: ≥95% (HPLC)
Biological Activity for Galanin (1-30) (human)
Galanin (1-30) (human) is a endogenous peptide with multiple endocrine, metabolic and behavioral effects. Has been shown to have an action on intestinal smooth muscle, insulin and somatostatin release, and synaptic neurotransmission.
Technical Data for Galanin (1-30) (human)
| M. Wt | 3157.41 |
| Formula | C139H210N42O43 |
| Sequence | GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 119418-04-1 |
| PubChem ID | 16133823 |
| InChI Key | CBSXZYWGVAQSHI-RUKUCZSXSA-N |
| Smiles | [H]NCC(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for Galanin (1-30) (human)
| Solubility | Soluble to 0.50 mg/ml in water |
Product Datasheets for Galanin (1-30) (human)
References for Galanin (1-30) (human)
References are publications that support the biological activity of the product.
Niiro et al (1998) Mechanisms of galanin-induced contraction in the rat myometrium. Br.J.Pharmacol. 124 1623 PMID: 9756377
Schmidt et al (1991) Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide. Proc.Natl.Acad.Sci.U.S.A. 88 11435 PMID: 1722333
Wang et al (1998) Hypothalamic galanin: control by signals of fat metabolism. Brain Res. 804 7 PMID: 9729239
If you know of a relevant reference for Galanin (1-30) (human), please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: Galanin (1-30) (human), Galanin (1-30) (human) supplier, Endogenous, galanin, agonists, GAL, GalR, Receptors, Galanin, 1179, Tocris Bioscience
2 Citations for Galanin (1-30) (human)
Citations are publications that use Tocris products. Selected citations for Galanin (1-30) (human) include:
Chiu et al (2013) Bacteria activate sensory neurons that modulate pain and inflammation. Nature 501 52 PMID: 23965627
Camp et al (2016) Dynamic mass redistribution reveals diverging importance of PDZ-ligands for G protein-coupled receptor pharmacodynamics. Pharmacol Res 105 13 PMID: 26773201
Do you know of a great paper that uses Galanin (1-30) (human) from Tocris? Please let us know.
Reviews for Galanin (1-30) (human)
There are currently no reviews for this product. Be the first to review Galanin (1-30) (human) and earn rewards!
Have you used Galanin (1-30) (human)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Peptides Involved in Appetite Modulation Scientific Review
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.