Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewGuangxitoxin 1E
Description: Potent Kv2.1 and Kv2.2 channel blocker
Purity: ≥95% (HPLC)
Biological Activity for Guangxitoxin 1E
Guangxitoxin 1E is a Kv2.1 and Kv2.2 channel blocker (IC50 values are 1-3 nM). Enhances glucose-stimulated insulin secretion from human islets in vitro, but not from islet cells lacking the Kv2.1 channel. Has no significant effect on plasma insulin, glucagon or blood glucose levels in mice, but increases plasma somatostatin levels.
Technical Data for Guangxitoxin 1E
| M. Wt | 3948.61 |
| Formula | C178H248N44O45S7 |
| Sequence |
EGECGGFWWKCGSGKPACCPKYVCSPKWGLCNFPMP (Modifications: Disulfide bridges: 4-19, 11-24, 18-31) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 1233152-82-3 |
| PubChem ID | 121513878 |
| InChI Key | SZVUKNYCMKWHNH-UHFFFAOYSA-N |
| Smiles | [H]N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CO)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)CNC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N3)NC(=O)[C@@H](NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C2=O)C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for Guangxitoxin 1E
| Solubility | Soluble to 1 mg/ml in water |
Product Datasheets for Guangxitoxin 1E
References for Guangxitoxin 1E
References are publications that support the biological activity of the product.
Li et al (2013) The role of voltage-gated potassium channels Kv2.1 and Kv2.2 in the regulation of Ins and somatostatin release from pancreatic islets. J.Pharmacol.Exp.Ther. 344 407 PMID: 23161216
Herrington (2007) Gating modifier peptides as probes of pancreatic beta-cell physiology. Toxicon 49 231 PMID: 17101164
If you know of a relevant reference for Guangxitoxin 1E, please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: Guangxitoxin 1E, Guangxitoxin 1E supplier, Kv2.1, Kv2.2, inward, rectifier, potassium, current, pancreatic, islets, beta, cells, inhibits, inhibitors, insulin, glucose, somatostatin, GxTx-1E, venoms, Voltage-Gated, Potassium, Channels, 5676, Tocris Bioscience
1 Citation for Guangxitoxin 1E
Citations are publications that use Tocris products. Selected citations for Guangxitoxin 1E include:
Il-Whan et al (2017) Escitalopram, a selective serotonin reuptake inhibitor, inhibits voltage-dependent K+ channels in coronary arterial smooth muscle cells. Korean J Physiol Pharmacol 21 415-421 PMID: 28706455
Do you know of a great paper that uses Guangxitoxin 1E from Tocris? Please let us know.
Reviews for Guangxitoxin 1E
Average Rating: 5 (Based on 1 Review.)
Have you used Guangxitoxin 1E?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Filter by:
Use of Guangxitoxin 1E in several BK channel studies.
By
Anonymous on 01/31/2019
Assay Type: In Vitro
Species: Human
Our lab has used Guangxitoxin 1E in several BK channel studies over the last few years. Our results have always been reliable and reproducible. We will surely continue using this product.
