Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewInsulin (human, recombinant, expressed in yeast) is an endogenous insulin receptor agonist (Ki = 4.85 nM). Decreases plasma glucose levels, proteolysis, lipolysis and gluconeogenesis and increases glycogen and fatty acid synthesis in vivo.
M. Wt | 5807.57 |
Formula | C257H383N65O77S6 |
Sequence |
GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT* (Modifications: Disulfide bridges: 6-11, 7-7*, 20-19*) |
Storage | Store at -20°C |
CAS Number | 11061-68-0 |
PubChem ID | 44379551 |
InChI Key | YZSPVSFRBZGLIZ-QIJQHHJSSA-N |
Smiles | [H]NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC3=CNC=N3)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC2=O)C(=O)N[C@@H](CC(N)=O)C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC2=CNC=N2)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N[H])CC2=CC=CC=C2)C(C)C)C(C)C)C(C)C)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC2=CC=CC=C2)C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)N[C@@H](CC2=CC=C(O)C=C2)C(=O)N[C@@H]([C@@H](C)O)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)NC1=O)[C@@H](C)O)[C@@H](C)CC |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility | Soluble to 10 mg/ml in aq. HCl (pH 2.0 - 2.5) |
References are publications that support the biological activity of the product.
Torlinska et al (2000) Age dependent changes of Ins receptors in rat tissues. J.Physiol.Pharmacol. 51 871 PMID: 11220495
Ou et al (2001) The binding characteristics of Ins-MTX to Ins receptor. Hua.Xi.Yi.Ke.Da.Xue.Xue.Bao. 32 538 PMID: 12528542
Leney and Tavare (2009) The molecular basis of Ins-stimulated glucose uptake: signalling, trafficking and potential drug targets. J.Endocrinol. 203 1 PMID: 19389739
If you know of a relevant reference for Insulin (human) recombinant, expressed in yeast, please let us know.
Keywords: Insulin (human) recombinant, expressed in yeast, Insulin (human) recombinant, expressed in yeast supplier, Endogenous, peptide, agonists, IGF, Receptors, nsulin-like, Receptor, Tyrosine, Kinases, RTKs, Insulin, and, insulin-like, Insulin-like, 3435, Tocris Bioscience
Citations are publications that use Tocris products. Selected citations for Insulin (human) recombinant, expressed in yeast include:
Yiling et al (2023) Microglia-containing cerebral organoids derived from induced pluripotent stem cells for the study of neurological diseases. iScience 26 106267 PMID: 36936782
Dodd et al (2018) ins. regulates POMC neuronal plasticity to control glucose metabolism. Elife 7 PMID: 30230471
Jens C et al (2017) A Hypothalamic Phosphatase Switch Coordinates Energy Expenditure with Feeding. Cell Metab 26 375-393.e7 PMID: 28768176
Thomas S et al (2021) Altered temporal sequence of transcriptional regulators in the generation of human cerebellar granule cells. Elife 10 PMID: 34842137
Yana et al (2020) Murine- and Human-Derived Autologous Organoid/Immune Cell Co-Cultures as Pre-Clinical Models of Pancreatic Ductal Adenocarcinoma. Cancers (Basel) 12 PMID: 33348809
Pinheiro et al (2016) Hierarchical glucocorticoid-endocannabinoid interplay regulates the activation of the nucleus accumbens by insulin. Brain.Res.Bull. 124 222 PMID: 27208730
Stretton et al (2015) GSK3-mediated raptor phosphorylation supports amino-acid-dependent mTORC1-directed signalling. Br J Pharmacol 470 207 PMID: 26348909
Do you know of a great paper that uses Insulin (human) recombinant, expressed in yeast from Tocris? Please let us know.
There are currently no reviews for this product. Be the first to review Insulin (human) recombinant, expressed in yeast and earn rewards!
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.