Insulin (human) recombinant, expressed in yeast

Pricing Availability   Qty
Description: Endogenous peptide agonist
Datasheet
Citations (7)
Reviews
Literature (2)
Pathways (1)

Biological Activity

Insulin (human, recombinant, expressed in yeast) is an endogenous insulin receptor agonist (Ki = 4.85 nM). Decreases plasma glucose levels, proteolysis, lipolysis and gluconeogenesis and increases glycogen and fatty acid synthesis in vivo.

Technical Data

M. Wt 5807.57
Formula C257H383N65O77S6
Sequence GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT*

(Modifications: Disulfide bridges: 6-11, 7-7*, 20-19*)

Storage Store at -20°C
CAS Number 11061-68-0
PubChem ID 44379551
InChI Key YZSPVSFRBZGLIZ-QIJQHHJSSA-N
Smiles [H]NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC3=CNC=N3)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC2=O)C(=O)N[C@@H](CC(N)=O)C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC2=CNC=N2)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N[H])CC2=CC=CC=C2)C(C)C)C(C)C)C(C)C)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC2=CC=CC=C2)C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)N[C@@H](CC2=CC=C(O)C=C2)C(=O)N[C@@H]([C@@H](C)O)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)NC1=O)[C@@H](C)O)[C@@H](C)CC

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data

Solubility Soluble to 10 mg/ml in aq. HCl (pH 2.0 - 2.5)

Product Datasheets

Certificate of Analysis / Product Datasheet
Select another batch:

References

References are publications that support the biological activity of the product.

Torlinska et al (2000) Age dependent changes of Ins receptors in rat tissues. J.Physiol.Pharmacol. 51 871 PMID: 11220495

Ou et al (2001) The binding characteristics of Ins-MTX to Ins receptor. Hua.Xi.Yi.Ke.Da.Xue.Xue.Bao. 32 538 PMID: 12528542

Leney and Tavare (2009) The molecular basis of Ins-stimulated glucose uptake: signalling, trafficking and potential drug targets. J.Endocrinol. 203 1 PMID: 19389739


If you know of a relevant reference for Insulin (human) recombinant, expressed in yeast, please let us know.

View Related Products by Product Action

View all Insulin and Insulin-like Receptor Activators

Keywords: Insulin (human) recombinant, expressed in yeast, Insulin (human) recombinant, expressed in yeast supplier, Endogenous, peptide, agonists, IGF, Receptors, nsulin-like, Receptor, Tyrosine, Kinases, RTKs, Insulin, and, insulin-like, Insulin-like, 3435, Tocris Bioscience

7 Citations for Insulin (human) recombinant, expressed in yeast

Citations are publications that use Tocris products. Selected citations for Insulin (human) recombinant, expressed in yeast include:

Yana et al (2020) Murine- and Human-Derived Autologous Organoid/Immune Cell Co-Cultures as Pre-Clinical Models of Pancreatic Ductal Adenocarcinoma. Cancers (Basel) 12 PMID: 33348809

Pinheiro et al (2016) Hierarchical glucocorticoid-endocannabinoid interplay regulates the activation of the nucleus accumbens by insulin. Brain.Res.Bull. 124 222 PMID: 27208730

Stretton et al (2015) GSK3-mediated raptor phosphorylation supports amino-acid-dependent mTORC1-directed signalling. Br J Pharmacol 470 207 PMID: 26348909

Yiling et al (2023) Microglia-containing cerebral organoids derived from induced pluripotent stem cells for the study of neurological diseases. iScience 26 106267 PMID: 36936782


Do you know of a great paper that uses Insulin (human) recombinant, expressed in yeast from Tocris? Please let us know.

Reviews for Insulin (human) recombinant, expressed in yeast

There are currently no reviews for this product. Be the first to review Insulin (human) recombinant, expressed in yeast and earn rewards!

Have you used Insulin (human) recombinant, expressed in yeast?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.

Angiogenesis in Cancer Poster

Angiogenesis in Cancer Poster

This poster summarizes the pathogenesis of angiogenesis in cancer, as well as some of the main angiogenesis therapeutic targets.

Pathways for Insulin (human) recombinant, expressed in yeast

Insulin Signaling Pathway

Insulin Signaling Pathway

Signaling through the insulin pathway is fundamental for the regulation of intracellular glucose levels. This pathway can become dysregulated in diabetes.