Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewJingzhaotoxin III
Description: Selective NaV1.5 channel blocker
Purity: ≥95% (HPLC)
Biological Activity for Jingzhaotoxin III
Jingzhaotoxin III is a selective blocker of NaV1.5 channels (IC50 = 348 nM); displays no effect on other isoforms, including NaV1.2, NaV1.4, NaV1.6 and NaV1.7. Thought to inhibit sodium channel activation by binding to the NaV1.5 S3-S4 linker of domain II. Selectively inhibits the activation of cardiac sodium channels, but has no effect on sodium channels in dorsal root ganglion neurons.
Technical Data for Jingzhaotoxin III
| M. Wt | 3919.5 |
| Formula | C174H241N47O46S6 |
| Sequence |
DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP (Modifications: Disulfide bridges: 4-19, 11-24, 18-31) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 925463-91-8 |
| PubChem ID | 90488988 |
| InChI Key | OKELXNUZHJLTAQ-UHFFFAOYSA-N |
| Smiles | [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)CNC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)CNC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)[C@H](C)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)CNC(=O)[C@H](CCCCN)NC2=O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for Jingzhaotoxin III
| Solubility | Soluble to 1 mg/ml in water |
Product Datasheets for Jingzhaotoxin III
References for Jingzhaotoxin III
References are publications that support the biological activity of the product.
Xiao et al (2004) Jingzhaotoxin-III, a novel spider toxin inhibiting activation of sodium channel in rat cardiac myocytes. J.Biol.Chem. 279 26220 PMID: 15084603
Rong et al (2011) Molecular basis of the tarantula toxin jingzhaotoxin-III (β-TRTX-Cj1α) interacting with voltage sensors in sodium channel subtype Nav1.5. FASEB J. 25 3177 PMID: 21665957
If you know of a relevant reference for Jingzhaotoxin III, please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: Jingzhaotoxin III, Jingzhaotoxin III supplier, cardiotoxins, NaV1.5, selective, ion, channels, sodium, blockers, blocks, inhibitors, inhibits, venoms, Voltage-gated, Sodium, Channels, 4913, Tocris Bioscience
Citations for Jingzhaotoxin III
Citations are publications that use Tocris products.
Currently there are no citations for Jingzhaotoxin III. Do you know of a great paper that uses Jingzhaotoxin III from Tocris? Please let us know.
Reviews for Jingzhaotoxin III
There are currently no reviews for this product. Be the first to review Jingzhaotoxin III and earn rewards!
Have you used Jingzhaotoxin III?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image