Margatoxin

Discontinued Product

3563 has been discontinued.

View all Voltage-gated Potassium (K<sub>V</sub>) Channels products.
Description: Potent KV1.3 channel blocker
Alternative Names: MgTX
Purity: ≥95% (HPLC)
Datasheet
Citations (1)
Reviews (1)

Biological Activity for Margatoxin

Margatoxin is a potent KV1.3 channel blocker (IC50 = 36 pM). Displays no effect at calcium-activated channels. Reduces VEGF-induced transmembrane calcium influxes and nitric oxide production in human endothelial cells.

Technical Data for Margatoxin

M. Wt 4178.96
Formula C178H286N52O50S7
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH

(Modifications: Disulfide bridges: 7-29, 13-34, 17-36)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 145808-47-5
PubChem ID 121596045
InChI Key OVJBOPBBHWOWJI-FYNXUGHNSA-N
Smiles [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CO)NC(=O)[C@@H](NC1=O)[C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC2=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for Margatoxin

Certificate of Analysis / Product Datasheet
Select another batch:

References for Margatoxin

References are publications that support the biological activity of the product.

Garcia-Calvo et al (1993) Purification, characterization, and biosynthesis of Margatoxin, a component of Centruroides margaritatus venom that selectively inhibits voltage-dependent potassium channels. J.Biol.Chem. 268 18866 PMID: 8360176

Erdogan et al (2005) Margatoxin inhibits VEGF-induced hyperpolarization, proliferation and nitric oxide production of human endothelial cells. J.Vasc.Res. 42 368 PMID: 16043967

View Related Products by Product Action

View all Voltage-gated Potassium (KV) Channel Blockers

Keywords: Margatoxin, Margatoxin supplier, Kv1.3, channel, blocker, voltage-gated, potassium, channels, MgTX, MTX, venoms, Voltage-Gated, Potassium, Channels, 3563, Tocris Bioscience

1 Citation for Margatoxin

Citations are publications that use Tocris products. Selected citations for Margatoxin include:

Frauke et al (2020) β1-Integrin- and KV1.3 channel-dependent signaling stimulates glutamate release from Th17 cells. J Clin Invest 130 715-732 PMID: 31661467


Reviews for Margatoxin

Average Rating: 5 (Based on 1 Review.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used Margatoxin?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


Great water soluble selective Kv channel blocker.
By Anonymous on 10/15/2018
Assay Type: In Vitro
Species: Human

Margatoxin was used in our lab to study SK channel opening and blocking effect. Margatoxin was used to compare with other selective SK channel blockers as they do not show significant SK blocking. The product performed excellent in sterile cell culture labs and would high recommend. The product is water soluble which is also a plus.

review image