Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewMargatoxin
Discontinued Product
3563 has been discontinued.
View all Voltage-gated Potassium (K<sub>V</sub>) Channels products.
Description: Potent KV1.3 channel blocker
Alternative Names: MgTX
Purity: ≥95% (HPLC)
Biological Activity for Margatoxin
Margatoxin is a potent KV1.3 channel blocker (IC50 = 36 pM). Displays no effect at calcium-activated channels. Reduces VEGF-induced transmembrane calcium influxes and nitric oxide production in human endothelial cells.
Technical Data for Margatoxin
| M. Wt | 4178.96 |
| Formula | C178H286N52O50S7 |
| Sequence |
TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Modifications: Disulfide bridges: 7-29, 13-34, 17-36) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 145808-47-5 |
| PubChem ID | 121596045 |
| InChI Key | OVJBOPBBHWOWJI-FYNXUGHNSA-N |
| Smiles | [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CO)NC(=O)[C@@H](NC1=O)[C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC2=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for Margatoxin
References for Margatoxin
References are publications that support the biological activity of the product.
Garcia-Calvo et al (1993) Purification, characterization, and biosynthesis of Margatoxin, a component of Centruroides margaritatus venom that selectively inhibits voltage-dependent potassium channels. J.Biol.Chem. 268 18866 PMID: 8360176
Erdogan et al (2005) Margatoxin inhibits VEGF-induced hyperpolarization, proliferation and nitric oxide production of human endothelial cells. J.Vasc.Res. 42 368 PMID: 16043967
View Related Products by Target
View Related Products by Product Action
Keywords: Margatoxin, Margatoxin supplier, Kv1.3, channel, blocker, voltage-gated, potassium, channels, MgTX, MTX, venoms, Voltage-Gated, Potassium, Channels, 3563, Tocris Bioscience
1 Citation for Margatoxin
Citations are publications that use Tocris products. Selected citations for Margatoxin include:
Frauke et al (2020) β1-Integrin- and KV1.3 channel-dependent signaling stimulates glutamate release from Th17 cells. J Clin Invest 130 715-732 PMID: 31661467
Reviews for Margatoxin
Average Rating: 5 (Based on 1 Review.)
Have you used Margatoxin?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Filter by:
Great water soluble selective Kv channel blocker.
By
Anonymous on 10/15/2018
Assay Type: In Vitro
Species: Human
Margatoxin was used in our lab to study SK channel opening and blocking effect. Margatoxin was used to compare with other selective SK channel blockers as they do not show significant SK blocking. The product performed excellent in sterile cell culture labs and would high recommend. The product is water soluble which is also a plus.
