Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewMetastin (human)
Description: Potent, endogenous ligand for kisspeptin receptor
Alternative Names: Kisspeptin-54,Kp-54
Purity: ≥95% (HPLC)
Biological Activity for Metastin (human)
Metastin (human) is a potent endogenous ligand of the kisspeptin receptor (KISS1, GPR54). Binds with high affinity to rat and human KISS1 receptors with Ki values of 1.80 and 1.45 nM respectively. Inhibits chemotaxis, invasion and metastasis of human melanomas and breast carcinomas. Stimulates gonadotropin secretion following i.c.v. administration.
Technical Data for Metastin (human)
| M. Wt | 5857.49 |
| Formula | C258H401N79O78 |
| Sequence |
GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF (Modifications: Phe-54 = C-terminal amide) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 374683-24-6 |
| PubChem ID | 71306396 |
| InChI Key | KAHDONZOCXSKII-NJVVDGNHSA-N |
| Smiles | [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for Metastin (human)
| Solubility | Soluble to 1 mg/ml in water |
Product Datasheets for Metastin (human)
References for Metastin (human)
References are publications that support the biological activity of the product.
Gottsch et al (2004) A role for kisspeptins in the regulation of g.tropin secretion in the mouse. Endocrinology 145 4073 PMID: 15217982
Kotani et al (2001) The metastasis suppressor gene KiSS-1 encodes kisspeptins, the natural ligands of the orphan G protein-coupled receptor GPR54. J.Biol.Chem. 276 34631 PMID: 11457843
Ohtaki et al (2001) Metastasis suppressor gene KiSS-1 encodes peptide ligand of a G-protein-coupled receptor. Nature 411 613 PMID: 11385580
If you know of a relevant reference for Metastin (human), please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: Metastin (human), Metastin (human) supplier, Potent, endogenous, ligand, KISS1, receptors, hOT7T175, AXOR12, GPR54, Metastin, KISS-derived, Peptides, Kisspeptin, Kisspeptin-54, Kp-54, Receptor, 1443, Tocris Bioscience
1 Citation for Metastin (human)
Citations are publications that use Tocris products. Selected citations for Metastin (human) include:
Fayazi et al (2015) The pregnant mouse uterus exhibits a functional kisspeptin/KISS1R signaling system on the day of embryo implantation. Nat Chem Biol 13 105 PMID: 26384646
Do you know of a great paper that uses Metastin (human) from Tocris? Please let us know.
Reviews for Metastin (human)
There are currently no reviews for this product. Be the first to review Metastin (human) and earn rewards!
Have you used Metastin (human)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image