PACAP 1-38

Pricing Availability   Qty
Description: Potent stimulator of adenylyl cyclase
Alternative Names: Pituitary Adenylate Cyclase-Activating Polypeptide 1-38
Purity: ≥95% (HPLC)
Datasheet
Citations (3)
Reviews

Biological Activity for PACAP 1-38

PACAP 1-38 is a potent endogenous neuropeptide (IC50 = 2 nM) showing considerable homology with vasoactive intestinal peptide (VIP) but with a greater potency for stimulation of adenylyl cyclase. PACAP 1-38 induces phosphorylation of NR2B and enhances NMDA receptor potentials.

Technical Data for PACAP 1-38

M. Wt 4534
Formula C203H331N63O53S
Sequence HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK

(Modifications: Lys-38 = C-terminal amide)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 137061-48-4
PubChem ID 44566111
InChI Key UFTCZKMBJOPXDM-XXFCQBPRSA-N
Smiles [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for PACAP 1-38

Solubility Soluble to 0.90 mg/ml in water

Product Datasheets for PACAP 1-38

Certificate of Analysis / Product Datasheet
Select another batch:

View Related Products by Product Action

View all PACAP Receptor Agonists

Keywords: PACAP 1-38, PACAP 1-38 supplier, Potently, stimulates, adenylyl, cyclases, stimulator, adenylate, Inositol, cAMP, Signaling, Signalling, Pituitary, Adenylate, Activating, Peptide, Receptors, PAC1, PACAP138, Cyclase-Activating, Polypeptide, 1-38, PACAP, Adenylyl, Cyclase, 1186, Tocris Bioscience

3 Citations for PACAP 1-38

Citations are publications that use Tocris products. Selected citations for PACAP 1-38 include:

Xiao et al (2019) PACAP ameliorates hepatic metabolism and inflammation through up-regulating FAIM in obesity. J Cell Mol Med PMID: 31270932

Nostramo et al (2012) Regulation of angiotensin II type 2 receptor gene expression in the adrenal medulla by acute and repeated immobilization stress. J Cereb Blood Flow Metab 215 291 PMID: 22911895

Sakamoto et al (2015) Pituitary adenylate cyclase-activating polypeptide protects glomerular podocytes from inflammatory injuries. J Diabetes Res 2015 727152 PMID: 25821833


Do you know of a great paper that uses PACAP 1-38 from Tocris? Please let us know.

Reviews for PACAP 1-38

There are currently no reviews for this product. Be the first to review PACAP 1-38 and earn rewards!

Have you used PACAP 1-38?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review