Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewPACAP 1-38 is a potent endogenous neuropeptide (IC50 = 2 nM) showing considerable homology with vasoactive intestinal peptide (VIP) but with a greater potency for stimulation of adenylyl cyclase. PACAP 1-38 induces phosphorylation of NR2B and enhances NMDA receptor potentials.
M. Wt | 4534 |
Formula | C203H331N63O53S |
Sequence |
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK (Modifications: Lys-38 = C-terminal amide) |
Storage | Store at -20°C |
Purity | ≥95% (HPLC) |
CAS Number | 137061-48-4 |
PubChem ID | 44566111 |
InChI Key | UFTCZKMBJOPXDM-XXFCQBPRSA-N |
Smiles | [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility | Soluble to 0.90 mg/ml in water |
References are publications that support the biological activity of the product.
Lazarovici et al (1998) The 38-amino-acid form of pituitary adenylate cyclase-activating polypeptide induces neurite outgrowth in PC12 cells that is dependent on protein kinase C and extracellular signal-regulated kinase but not on protein kinase A, nerve growth factor receptor Mol.Pharmacol. 54 547 PMID: 9730914
Michel et al (1998) XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 50 143 PMID: 9549761
Rawlings et al (1994) Pituitary adenylate cyclase-activating polypeptide increase [Ca2+]i in rat gonadotrophs through an inositol trisphosphate-dependent mechanism. J.Biol.Chem. 269 5680 PMID: 7907085
Robberecht et al (1992) Structural requirements for the occupancy of pituitary adenylate-cyclase-activating-peptide (PACAP) receptors and adenylate cyclase activation in human neuroblastoma NB-OK-1 cell membranes. Discovery of PACAP(6-38) as a potent antagonist. Eur.J.Biochem. 297 239 PMID: 1321043
Yaka et al (2003) Pituitary adenylate cyclase-activating polypeptide (PACAP(1-38)) enhances N-methyl-D-aspartate receptor function and brain-derived neurotrophic factor expression via RACK1. J.Biol.Chem. 278 9630 PMID: 12524444
If you know of a relevant reference for PACAP 1-38, please let us know.
Keywords: PACAP 1-38, PACAP 1-38 supplier, Potently, stimulates, adenylyl, cyclases, stimulator, adenylate, Inositol, cAMP, Signaling, Signalling, Pituitary, Adenylate, Activating, Peptide, Receptors, PAC1, PACAP138, Cyclase-Activating, Polypeptide, 1-38, PACAP, Adenylyl, Cyclase, 1186, Tocris Bioscience
Citations are publications that use Tocris products. Selected citations for PACAP 1-38 include:
Xiao et al (2019) PACAP ameliorates hepatic metabolism and inflammation through up-regulating FAIM in obesity. J Cell Mol Med PMID: 31270932
Nostramo et al (2012) Regulation of angiotensin II type 2 receptor gene expression in the adrenal medulla by acute and repeated immobilization stress. J Cereb Blood Flow Metab 215 291 PMID: 22911895
Sakamoto et al (2015) Pituitary adenylate cyclase-activating polypeptide protects glomerular podocytes from inflammatory injuries. J Diabetes Res 2015 727152 PMID: 25821833
Do you know of a great paper that uses PACAP 1-38 from Tocris? Please let us know.
There are currently no reviews for this product. Be the first to review PACAP 1-38 and earn rewards!
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image