Home / Pharmacology / GPCRs / 7-TM Receptors / Peptide Receptors / PACAP Receptors / PACAP Receptor Antagonists / PACAP 6-38

PACAP 6-38

Cat. No. 3236 1 Citation Submit a Review Datasheet / COA / SDS
Pricing Availability   Qty
Description: Potent PAC1 receptor antagonist
Purity: ≥95% (HPLC)
Datasheet
Citations (1)
Reviews
Biological Activity Technical Data Solubility Calculators Datasheets References

Biological Activity for PACAP 6-38

PACAP 6-38 is a potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist (IC50 = 2 nM). Inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Antitumor activity in vivo.

Technical Data for PACAP 6-38

M. Wt 4024.78
Formula C182H300N56O45S
Sequence FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK

(Modifications: Lys-33 = C-terminal amide)
Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 143748-18-9
PubChem ID 24868185
InChI Key BGZYREVJBMQLGS-ONKNJJKASA-N
Smiles [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for PACAP 6-38

Solubility Soluble to 2 mg/ml in water

Product Datasheets for PACAP 6-38

Certificate of Analysis / Product Datasheet
Select another batch:
Safety Datasheet

References for PACAP 6-38

References are publications that support the biological activity of the product.

Robberecht et al (1992) Structural requirements for the occupancy of pituitary adenylate-cyclase-activating-peptide (PACAP) receptors and adenylate cyclase activation in human neuroblastoma NB-OK-1 cell membranes. Discovery of PACAP(6-38) as a potent antagonist. Eur.J.Biochem. 207 239 PMID: 1321043

Leyton et al (1998) PACAP(6-38) inhibits growth of prostate cancer cells. Cancer Lett. 125 131 PMID: 9566707

Kojro et al (2006) The neuropeptide PACAP promotes a-secretase pathway for processing Alzheimer amyloid precursor protein. FASEB J. 20 512 PMID: 16401644

If you know of a relevant reference for PACAP 6-38, please let us know.

View Related Products by Target

View Related Products by Product Action

View all PACAP Receptor Antagonists

Keywords: PACAP 6-38, PACAP 6-38 supplier, Potent, PAC1, receptors, antagonists, Pituitary, Adenylate, Cyclase, Activating, Peptide, PACAP638, PACAP, Receptors, 3236, Tocris Bioscience

1 Citation for PACAP 6-38

Citations are publications that use Tocris products. Selected citations for PACAP 6-38 include:

Maugeri et al (2016) PACAP and VIP Inhibit the Invasiveness of Glioblastoma Cells Exposed to Hypoxia through the Regulation of HIFs and EGFR Expression. Proc Natl Acad Sci U S A 7 139 PMID: 27303300

Do you know of a great paper that uses PACAP 6-38 from Tocris? Please let us know.

Reviews for PACAP 6-38

There are currently no reviews for this product. Be the first to review PACAP 6-38 and earn rewards!

Have you used PACAP 6-38?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review