Parstatin (human)

Discontinued Product

3553 has been discontinued.

View all Protease-Activated Receptors products.
Description: Peptide cleaved from PAR1 upon receptor activation
Datasheet
Citations
Reviews

Biological Activity for Parstatin (human)

Parstatin (human) is a cell-permeable peptide cleaved from protease-activated receptor 1 (PAR1) upon receptor activation. Attenuates endothelial cell migration and proliferation (IC50 ~ 3 μM), and induces cell cycle arrest. Promotes activation of caspase-3 and exhibits pro-apoptotic activity in vitro. Inhibits angiogenesis and exhibits cardioprotective activity in vivo.

Parstatin (mouse) also available.

Technical Data for Parstatin (human)

M. Wt 4467.29
Formula C191H330N64O53S3
Sequence MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR
Storage Store at -20°C
CAS Number 1065755-99-8
PubChem ID 90488856
InChI Key SVAINNLHALEEHP-HQNSSEMESA-N
Smiles [H]N[C@@H](CCSC)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for Parstatin (human)

References for Parstatin (human)

References are publications that support the biological activity of the product.

Zania et al (2009) Parstatin, the cleaved peptide on proteinase-activated receptor 1 activation, is a potent inhibitor of activation. J.Pharmacol.Exp.Ther. 328 378 PMID: 18988770

Strande et al (2009) Parstatin: a cryptic peptide involved in cardioprotection after ischaemic and reperfusion injury. Cardiovasc.Res. 83 325 PMID: 19380418

Keywords: Parstatin (human), Parstatin (human) supplier, Peptide, cleaved, PAR1, receptors, activation, Protease-Activated, proteinase-activated, Receptors, 3553, Tocris Bioscience

Citations for Parstatin (human)

Citations are publications that use Tocris products.

Currently there are no citations for Parstatin (human).

Reviews for Parstatin (human)

There are currently no reviews for this product. Be the first to review Parstatin (human) and earn rewards!

Have you used Parstatin (human)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review