Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewPhrixotoxin 3
Description: Potent blocker of NaV1.2, NaV1.3 and NaV1.5 channels
Purity: ≥95% (HPLC)
Biological Activity for Phrixotoxin 3
Phrixotoxin 3 is a potent blocker of voltage-gated sodium channels (IC50 values are 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Blocks inward sodium currents in a voltage-dependent manner.
Technical Data for Phrixotoxin 3
| M. Wt | 4059.74 |
| Formula | C176H269N51O48S6 |
| Sequence |
DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI (Modifications: Disulfide bridges: 2-17, 9-23, 16-30) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 880886-00-0 |
| PubChem ID | 90488989 |
| InChI Key | SOKDRDMJNDICMO-UHFFFAOYSA-N |
| Smiles | [H]N[C@@H](CC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)CNC(=O)[C@H](CC(C)C)NC1=O)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N3)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC2=O)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for Phrixotoxin 3
| Solubility | Soluble to 1 mg/ml in water |
Product Datasheets for Phrixotoxin 3
References for Phrixotoxin 3
References are publications that support the biological activity of the product.
Bosmans et al (2006) Four novel tarantula toxins as selective modulators of voltage-gated sodium channel subtypes. Mol.Pharmacol. 69 419 PMID: 16267209
Ono et al (2011) Characterization of voltage-dependent calcium channel blocking peptides from the venom of the tarantula Grammostola rosea. Toxicon. 58 265 PMID: 21740921
If you know of a relevant reference for Phrixotoxin 3, please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: Phrixotoxin 3, Phrixotoxin 3 supplier, modulators, modulates, sodium, voltage-gated, channels, NaV1.2, NaV1.3, NaV1.5, venoms, Voltage-gated, Sodium, Channels, 4914, Tocris Bioscience
Citations for Phrixotoxin 3
Citations are publications that use Tocris products.
Currently there are no citations for Phrixotoxin 3. Do you know of a great paper that uses Phrixotoxin 3 from Tocris? Please let us know.
Reviews for Phrixotoxin 3
Average Rating: 5 (Based on 1 Review.)
Have you used Phrixotoxin 3?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Filter by:
Study of the depolarizing shift in gating kinetics by Phrixotoxin 3.
By
Anonymous on 01/16/2020
Assay Type: In Vivo
Species: Mouse
We studied the depolarizing shift in gating kinetics and blocking of the inward component of the sodium current by Phrixotoxin 3.
