Phrixotoxin 3

Pricing Availability   Qty
Description: Potent blocker of NaV1.2, NaV1.3 and NaV1.5 channels
Purity: ≥95% (HPLC)
Datasheet
Citations
Reviews (1)

Biological Activity for Phrixotoxin 3

Phrixotoxin 3 is a potent blocker of voltage-gated sodium channels (IC50 values are 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Blocks inward sodium currents in a voltage-dependent manner.

Technical Data for Phrixotoxin 3

M. Wt 4059.74
Formula C176H269N51O48S6
Sequence DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI

(Modifications: Disulfide bridges: 2-17, 9-23, 16-30)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 880886-00-0
PubChem ID 90488989
InChI Key SOKDRDMJNDICMO-UHFFFAOYSA-N
Smiles [H]N[C@@H](CC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)CNC(=O)[C@H](CC(C)C)NC1=O)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N3)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC2=O)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Phrixotoxin 3

Solubility Soluble to 1 mg/ml in water

Product Datasheets for Phrixotoxin 3

Certificate of Analysis / Product Datasheet
Select another batch:

References for Phrixotoxin 3

References are publications that support the biological activity of the product.

Bosmans et al (2006) Four novel tarantula toxins as selective modulators of voltage-gated sodium channel subtypes. Mol.Pharmacol. 69 419 PMID: 16267209

Ono et al (2011) Characterization of voltage-dependent calcium channel blocking peptides from the venom of the tarantula Grammostola rosea. Toxicon. 58 265 PMID: 21740921


If you know of a relevant reference for Phrixotoxin 3, please let us know.

View Related Products by Product Action

View all Voltage-gated Sodium (NaV) Channel Blockers

Keywords: Phrixotoxin 3, Phrixotoxin 3 supplier, modulators, modulates, sodium, voltage-gated, channels, NaV1.2, NaV1.3, NaV1.5, venoms, Voltage-gated, Sodium, Channels, 4914, Tocris Bioscience

Citations for Phrixotoxin 3

Citations are publications that use Tocris products.

Currently there are no citations for Phrixotoxin 3. Do you know of a great paper that uses Phrixotoxin 3 from Tocris? Please let us know.

Reviews for Phrixotoxin 3

Average Rating: 5 (Based on 1 Review.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used Phrixotoxin 3?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


Study of the depolarizing shift in gating kinetics by Phrixotoxin 3.
By Anonymous on 01/16/2020
Assay Type: In Vivo
Species: Mouse

We studied the depolarizing shift in gating kinetics and blocking of the inward component of the sodium current by Phrixotoxin 3.

review image