Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewBiological Activity for Pramlintide
Pramlintide is a synthetic version of amylin (Cat. No. 3418). Exhibits high affinity for amylin, CGRP and calcitonin receptors (Ki values are 0.023, 3.8 and 5.1 nM respectively). Reduces postprandial hyperglycemia; also inhibits gastric emptying.
Technical Data for Pramlintide
| M. Wt | 3949.42 |
| Formula | C171H267N51O53S2 |
| Sequence |
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY (Modifications: Tyr-37 = C-terminal amide, Disulfide bridge: 2-7) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 151126-32-8 |
| PubChem ID | 70691388 |
| InChI Key | TZIRZGBAFTZREM-MKAGXXMWSA-N |
| Smiles | [H]N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC1=O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for Pramlintide
| Solubility | Soluble to 1 mg/ml in water |
Product Datasheets for Pramlintide
References for Pramlintide
References are publications that support the biological activity of the product.
Young et al (1996) Preclinical pharmacology of pramli. in the rat: comparisons with human and rat amylin. Drug Dev.Res. 37 231
Hoogwerf et al (2008) Pramlintide, the synthetic analogue of amylin: phsyiology, pathophysiology, and effects on glycemic control, body weight, and selected biomarkers of vascular risk. Vasc.Health Risk Manag. 4 355 PMID: 18561511
If you know of a relevant reference for Pramlintide, please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: Pramlintide, Pramlintide supplier, Pramlintide, antidiabetic, amylin, synthetic, calcitonin, CGRP, receptors, Calcitonin, and, Related, Receptors, 5031, Tocris Bioscience
1 Citation for Pramlintide
Citations are publications that use Tocris products. Selected citations for Pramlintide include:
Stephen D et al (2021) Area Postrema Cell Types that Mediate Nausea-Associated Behaviors. Neuron 109 461-472.e5 PMID: 33278342
Do you know of a great paper that uses Pramlintide from Tocris? Please let us know.
Reviews for Pramlintide
There are currently no reviews for this product. Be the first to review Pramlintide and earn rewards!
Have you used Pramlintide?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Peptides Involved in Appetite Modulation Scientific Review
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.