Home / Pharmacology / Ion Channels / Calcium Channels / Voltage-gated Calcium Channels (CaV) / CaV3.x Channels (T-type) / CaV3.x Channel (T-type) Blockers / ProTx I

ProTx I

Cat. No. 4665 Submit a Review Datasheet / COA / SDS

Discontinued Product

4665 has been discontinued.

View all Ca<sub>V</sub>3.x Channels (T-type) products.
Description: CaV3.1 blocker; also inhibits NaV1.8 and KV2.1
Datasheet
Citations
Reviews
Biological Activity Technical Data Datasheets References

Biological Activity for ProTx I

ProTx I is a selective CaV3.1 channel blocker (IC50 values are 0.2 and 31.8 μM for hCaV3.1 and hCaV3.2 respectively). Also reversibly inhibits NaV1.8 and blocks KV2.1 channels.

Technical Data for ProTx I

M. Wt 3987.51
Formula C171H245N53O47S6
Sequence ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS

(Modifications: Disulfide bridge: 2-16, 9-21, 15-28)

Storage Store at -20°C
CAS Number 484598-35-8
PubChem ID 90488963
InChI Key TYAZSKURKBASCY-UHFFFAOYSA-N
Smiles [H]N[C@@H](CCC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)CNC(=O)[C@H](CC4=CNC=N4)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CSSC[C@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CCCNC(N)=N)NC1=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N3)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC1=CNC=N1)NC(=O)[C@H](CCCCN)NC2=O)C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for ProTx I

Certificate of Analysis / Product Datasheet
Select another batch:
Safety Datasheet

References for ProTx I

References are publications that support the biological activity of the product.

Ohkubo et al (2010) Tarantula toxin ProTx-I differentiates between human T-type voltage-gated Ca2+ channels Cav3.1 and Cav3.2. J.Pharmacol.Sci. 112 452 PMID: 20351484

Ohkubo and Yamazaki (2012) T-type voltage-activated calcium channel Cav3.1, but not Cav3.2, is involved in the inhibition of proliferation and apoptosis in MCF-7 human breast cancer cells. Int.J.Oncol. 41 267 PMID: 22469755

Middleton et al (2002) Two tarantula peptides inhibit activation of multiple sodium channels. Biochemistry 41 14734 PMID: 12475222

View Related Products by Target

View Related Products by Product Action

View all CaV3.x Channel (T-type) Blockers

Keywords: ProTx I, ProTx I supplier, ProTxI, calcium, sodium, potassium, ion, channels, NaV1.8, CaV3.1, CaV3.2, KV2.1, selective, blockers, venoms, Cav3.x, Channels, Voltage-gated, Sodium, Voltage-Gated, Potassium, 4665, Tocris Bioscience

Citations for ProTx I

Citations are publications that use Tocris products.

Currently there are no citations for ProTx I.

Reviews for ProTx I

There are currently no reviews for this product. Be the first to review ProTx I and earn rewards!

Have you used ProTx I?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review