Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewELA-32 (human)
Description: Potent and high affinity apelin agonist; stimulates angiogenesis
Alternative Names: APJ early endogenous ligand,Apela,Elabela,Toddler
Biological Activity for ELA-32 (human)
ELA-32 (human) is a potent, high affinity apelin receptor agonist (IC50 = 0.27 nM; Kd = 0.51 nM). Exhibits no binding GPR15 and GPR25. Activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. Also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. Stimulates angiogenesis in HUVEC cells. Relaxes mouse aortic vessels. Functions as an anorexigenic hormone through activation of the AVP and CRH neurons in the PVN.
Negative control (Cat.No. 6292) also available.
Licensing Information
Sold under agreement from the Agency for Science, Technology and Research (A*STAR), ETPL, and affiliates including the Institute of Medical Biology.
Technical Data for ELA-32 (human)
| M. Wt | 3967.8 |
| Formula | C170H289N63O39S4 |
| Sequence |
QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP (Modifications: Disulfide bridge: 17-22) |
| Storage | Store at -20°C |
| CAS Number | 1680205-79-1 |
| PubChem ID | 131648248 |
| InChI Key | QSDOQAYDPQAWEK-PXWSXZDTSA-N |
| Smiles | [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC1=O)C(=O)N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for ELA-32 (human)
References for ELA-32 (human)
References are publications that support the biological activity of the product.
Deng et al (2015) Apela Regulates Fluid Homeostasis by Binding to the APJ Receptor to Activate Gi Signaling. J.Biol.Chem 290 18261 PMID: 25995451
Wang et al (2015) Elabela-apelin receptor signaling pathway is functional in mammalian systems. Sci.Rep. 5 8170 PMID: 25639753
Chaves-Almagro et al (2015) Apelin receptors: From signaling to antidiabetic strategy. Eur.J.Pharmacol. 763 149 PMID: 26007641
Chng et al (2013) ELABELA: a hormone essential for heart development signals via the apelin receptor. Dev.Cell 27 672 PMID: 24316148
Ho et al (2015) ELABELA Is an Endogenous Growth Factor that Sustains hESC Self-Renewal via the PI3K/AKT Pathway. Cell Stem Cell 17 435 PMID: 26387754
Santoso et al (2015) Central action of ELABELA reduces food intake and activates arginine vasopressin and corticotropin-releasing hormone neurons in the hypothalamic paraventricular nucleus. Neuroreport 26 820 PMID: 26237243
Yang et al (2017) Elabela/Toddler Is an endogenous agonist of the apelin APJ receptor in the adult cardiovascular system, and exogenous administration of the peptide compensates for the downregulation of its expression in pulmonary arterial hypertension. Circulation 135 1160 PMID: 28137936
View Related Products by Target
View Related Products by Product Action
Keywords: ELA-32 (human), ELA-32 (human) supplier, APJ, early, endogenous, ligand, Apela, Elabela, Toddler, potent, high, affinity, apelin, receptors, agonists, agonism, self, renewal, hESCs, human, embryonic, cells, Apelin, Receptors, Stem, Cell, Proliferation, ESCs, and, iPSC, 6291, Tocris Bioscience
Citations for ELA-32 (human)
Citations are publications that use Tocris products.
Currently there are no citations for ELA-32 (human).
Reviews for ELA-32 (human)
There are currently no reviews for this product. Be the first to review ELA-32 (human) and earn rewards!
Have you used ELA-32 (human)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image