Home / Pharmacology / GPCRs / 7-TM Receptors / Peptide Receptors / Apelin Receptors / Apelin Receptor Controls / ELARR>GG

ELARR>GG

Cat. No. 6292 Submit a Review Datasheet / COA / SDS

Discontinued Product

6292 has been discontinued.

View all Apelin Receptors products.
Description: Negative control for ELA-32 (Cat.No.6291)
Alternative Names: ELA-32 negative control
Datasheet
Citations
Reviews
Biological Activity Technical Data Datasheets References

Biological Activity for ELARR>GG

ELARR>GG is an ELABELA mutant peptide. Negative control for ELA-32 (Cat.No.6291).

Technical Data for ELARR>GG

M. Wt 3769.55
Formula C162H271N57O39S4
Sequence QRPVNLTMGGKLRKHNCLQRRCMPLHSRVPFP

(Modifications: Disulfide bridge: 17-22)
Storage Store at -20°C
PubChem ID 134812835
InChI Key PFBRCXLUNUYGJU-JZFBDHSDSA-N
Smiles [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)NCC(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC1=O)C(=O)N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

References for ELARR>GG

References are publications that support the biological activity of the product.

Ho et al (2015) ELABELA is an endogenous growth factor that sustains hESC self-renewal via the PI3K/AKT pathway. Cell Stem Cell 17 435 PMID: 26387754

View Related Products by Target

View Related Products by Product Action

View all Apelin Receptor Controls

Keywords: ELA RR-GG, ELA RR-GG supplier, ELA-32, negative, control, mutant, peptide, ELABELA, Apelin, Receptors, Stem, Cell, Proliferation, ESCs, and, iPSC, 6292, Tocris Bioscience

Citations for ELARR>GG

Citations are publications that use Tocris products.

Currently there are no citations for ELARR>GG.

Reviews for ELARR>GG

There are currently no reviews for this product. Be the first to review ELARR>GG and earn rewards!

Have you used ELARR>GG?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review