Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewNeuropeptide Y (human, rat)
Description: Influences feeding and sexual behavior
Alternative Names: NPY (human,rat)
Purity: ≥95% (HPLC)
Biological Activity for Neuropeptide Y (human, rat)
Neuropeptide Y (human, rat) is a widely distributed endogenous neuropeptide involved in the control of food intake, sexual behavior and blood pressure.
Technical Data for Neuropeptide Y (human, rat)
| M. Wt | 4271.7 |
| Formula | C189H285N55O57S |
| Sequence |
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (Modifications: Tyr-36 = C-terminal amide) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 90880-35-6 |
| PubChem ID | 24868177 |
| InChI Key | XKWCTHKJQNUFOQ-HRPSIEBRSA-N |
| Smiles | [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for Neuropeptide Y (human, rat)
| Solubility | Soluble to 1 mg/ml in water |
Product Datasheets for Neuropeptide Y (human, rat)
References for Neuropeptide Y (human, rat)
References are publications that support the biological activity of the product.
Allen et al (1987) Molecular structure of mammalian neuropeptide Y: analysis by molecular cloning and computer-aided comparison with crystal structure of avian homologue. Proc.Natl.Acad.Sci.U.S.A. 84 2532 PMID: 3031687
Michel et al (1998) XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 50 143 PMID: 9549761
Minth et al (1984) Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine. Proc.Natl.Acad.Sci.U.S.A. 81 4577 PMID: 6589611
If you know of a relevant reference for Neuropeptide Y (human, rat), please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: Neuropeptide Y (human, rat), Neuropeptide Y (human, rat) supplier, Influences, feeding, sexual, behavior, Neuropeptide, Y, Receptors, NPY, agonists, NeuropeptideY, (human), neuropeptides, (human,, rat), 1153, Tocris Bioscience
4 Citations for Neuropeptide Y (human, rat)
Citations are publications that use Tocris products. Selected citations for Neuropeptide Y (human, rat) include:
Singer et al (2013) Neuropeptide Y is produced by adipose tissue macrophages and regulates obesity-induced inflammation. PLoS One 8 e57929 PMID: 23472120
Acton et al (2019) Spinal Neuropeptide Y1 Receptor-Expressing Neurons Form an Essential Excitatory Pathway for Mechanical Itch. Cell Rep 28 625 PMID: 31315043
Businaro et al (2018) Platelet Lysate-Derived Neuropeptide y Influences Migration and Angiogenesis of Human Adipose Tissue-Derived Stromal Cells. Sci Rep 8 14365 PMID: 30254326
Alhadeff et al (2018) A Neural Circuit for the Suppression of Pain by a Competing Need State. Cell 173 140 PMID: 29570993
Do you know of a great paper that uses Neuropeptide Y (human, rat) from Tocris? Please let us know.
Reviews for Neuropeptide Y (human, rat)
Average Rating: 5 (Based on 1 Review.)
Have you used Neuropeptide Y (human, rat)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Filter by:
Field Recording and Bath Application of NPY.
By
Aundrea Bartley on 01/05/2018
Assay Type: In Vitro
Species: Mouse
Bath application of NPY to acute hippocampal slices and recorded field responses
We precoated the tubing with 0.1 mg/ml of BSA to prevent issues of NPY sticking to the tubing. BSA cannot be added directly to the recording solution because of issues that arise during oxygenation.
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Peptides Involved in Appetite Modulation Scientific Review
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.