Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewPancreatic Polypeptide (human)
Description: NPY Y4 agonist; involved in gastrointestinal tract function
Purity: ≥95% (HPLC)
Biological Activity for Pancreatic Polypeptide (human)
Pancreatic Polypeptide (human) is an endogenous high affinity agonist for human NPY Y4 receptor (Ki = 0.056 nM). Believed to play an important role in the function of the gastrointestinal tract.
Technical Data for Pancreatic Polypeptide (human)
| M. Wt | 4181.7 |
| Formula | C185H287N53O54S2 |
| Sequence |
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY (Modification: Tyr-36 = C-terminal amide) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 75976-10-2 |
| PubChem ID | 24868176 |
| InChI Key | HFDKKNHCYWNNNQ-YOGANYHLSA-N |
| Smiles | [H]N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for Pancreatic Polypeptide (human)
| Solubility | Soluble to 0.70 mg/ml in water |
Product Datasheets for Pancreatic Polypeptide (human)
References for Pancreatic Polypeptide (human)
References are publications that support the biological activity of the product.
Bard et al (1995) Cloning and functional expression of a human Y4 subtype receptor for pancreatic polypeptide, neuropeptide Y, and peptide YY. J.Biol.Chem. 270 26762 PMID: 7592911
Gehlert (1998) Multiple receptors for the pancreatic polypeptide (PP-fold) family: physiological implications. Proc.Soc.Exp.Biol.Med. 218 7 PMID: 9572148
Michel et al (1998) XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 50 143 PMID: 9549761
If you know of a relevant reference for Pancreatic Polypeptide (human), please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: Pancreatic Polypeptide (human), Pancreatic Polypeptide (human) supplier, NPY, Y4, agonist, involved, gastrointestinal, tract, function, Neuropeptide, Y, Receptors, neuropeptides, 1154, Tocris Bioscience
Citations for Pancreatic Polypeptide (human)
Citations are publications that use Tocris products.
Currently there are no citations for Pancreatic Polypeptide (human). Do you know of a great paper that uses Pancreatic Polypeptide (human) from Tocris? Please let us know.
Reviews for Pancreatic Polypeptide (human)
There are currently no reviews for this product. Be the first to review Pancreatic Polypeptide (human) and earn rewards!
Have you used Pancreatic Polypeptide (human)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Peptides Involved in Appetite Modulation Scientific Review
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.