Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewParathyroid hormone (1-34) (human) is a human parathyroid hormone (hPTH) peptide fragment; contains the 34 N-terminal residues of hPTH. Agonist at parathyroid 1 (PTH1) and parathyroid 2 (PTH2) receptors.
M. Wt | 4117.75 |
Formula | C181H291N55O51S2 |
Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
Storage | Store at -20°C |
Purity | ≥95% (HPLC) |
CAS Number | 52232-67-4 |
PubChem ID | 16132393 |
InChI Key | OGBMKVWORPGQRR-UMXFMPSGSA-N |
Smiles | [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility | Soluble to 0.40 mg/ml in water |
References are publications that support the biological activity of the product.
Dobnig and Turner (1997) The effects of programmed administration of human parathyroid hormone fragment (1-34) on bone histomorphometry and serum chemistry in rats. Endocrinology 138 4607 PMID: 9348185
Manabe et al (2007) Human parathyroid hormone (1-34) accelerates natural fracture healing process in the femoral osteotomy model of cynomolgus monkeys. Bone 40 1475 PMID: 17369013
Niall et al (1974) The amino acid sequence of the amino-terminal 37 residues of human parathyroid hormone. Proc.Natl.Acad.Sci. 71 384
If you know of a relevant reference for Parathyroid hormone (1-34) (human), please let us know.
Keywords: Parathyroid hormone (1-34) (human), Parathyroid hormone (1-34) (human) supplier, Parathyroid, hormone, PTH, receptors, agonists, PTH134, 1-34, teriparatide, (1-34), hPTH, Teriparatide, Hormone, Receptors, 3011, Tocris Bioscience
Citations are publications that use Tocris products. Selected citations for Parathyroid hormone (1-34) (human) include:
Reinisch et al (2017) Generation and use of a humanized bone-marrow-ossicle niche for hematopoietic xenotransplantation into mice. Nat Protoc 12 2169 PMID: 28933777
Li et al (2019) TGFβ-induced degradation of TRAF3 in mesenchymal progenitor cells causes age-related osteoporosis. Nat Commun 10 2795 PMID: 31243287
Do you know of a great paper that uses Parathyroid hormone (1-34) (human) from Tocris? Please let us know.
There are currently no reviews for this product. Be the first to review Parathyroid hormone (1-34) (human) and earn rewards!
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image